KEGG   Rosa chinensis (China rose): 112185957Help
Entry
112185957         CDS       T06020                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK11
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
rcn  Rosa chinensis (China rose)
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rcn01001]
    112185957
   01009 Protein phosphatases and associated proteins [BR:rcn01009]
    112185957
Enzymes [BR:rcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112185957
Protein kinases [BR:rcn01001]
 Serine/threonine kinases: Other
  Wnk family
   112185957
Protein phosphatases and associated proteins [BR:rcn01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112185957
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C FlpD
Motif
Other DBs
NCBI-GeneID: 112185957
NCBI-ProteinID: XP_024180064
Position
2
AA seq 524 aa AA seqDB search
MERTESDTSECDYDEFVEQDPAGRYFRYDDVLGRGAFKTVYKAFDEEEGIEVAWSKVKTE
DEAELQRLFSEVNLLKSLKHENIIKLFSWWVVEDDDDNGDCKSKKNKKKKKKTVNMITEL
FTSGSLKQYRKKHTHVEIKAIKKWARQILKGLSYLHCHDPPIVHRDLKCDNVFINGFNGE
VKIGDLGFALVMQQPTTEFRVIGTPEFIAPEMYDEEYNELVDIYSFGLCLLEMVTCEYPY
KECRNSAHIYKKVINGVMPASLNKVKDPQVKQFIEKCLVPASMRLSAMELLKDPFLAADD
SRVPKSFPMEMDSRSVKESSTSSSSSILECQRSTKSNELTLRAKRNSDSSNTIALTLSVA
DPRGRRGKKTIEFDFYLDSDTAISIAGEMVDQELGLSTEDVSAVAELIDKLVMKLVPKWK
PTSSVAYCSCTTTRSDATKCGCGANSGDSSKNSTISSMEIWKSFSTSSICSLQSESSPMD
KHRYDHLKAELDLIDAQYQQRFVELVKMKEEAIRSAKKKLVGVV
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggagaggaccgaatctgatacgagtgagtgtgactacgacgagtttgtggagcaagac
ccggccgggaggtacttccggtacgacgacgttttggggaggggggcgttcaagactgtg
tacaaggcttttgatgaggaagaagggattgaagtggcgtggagcaaagtcaagactgag
gacgaggctgagcttcagagattgttttcggaggttaatctgctcaagtctttgaagcat
gagaacatcatcaagctttttagctggtgggttgtggaggatgatgacgataatggtgac
tgtaaatccaagaagaacaagaagaagaagaagaagactgtgaatatgataacggagctg
ttcacttccgggagcttgaagcagtatcgaaagaagcacacccatgttgagatcaaggcc
atcaagaaatgggcgcgtcagattctcaaggggctgagctatctgcactgtcatgaccct
ccgattgttcatagggatttgaagtgtgacaatgtgttcattaatgggtttaatggggaa
gtgaagattggagatctggggtttgcgttggtgatgcagcagcctactactgagtttaga
gtgattggcacgccggagtttatagcgccggagatgtatgacgaggagtataatgagttg
gtggatatctattcttttgggttgtgcttgctagaaatggtgacttgtgagtacccttac
aaggagtgtcgaaattcggctcatatttacaagaaggttatcaatggtgtaatgccggct
tctctgaataaagtgaaggatcctcaagtgaagcagttcattgagaagtgtctagttcct
gcatcgatgagattgtctgcaatggagctcctgaaagatccattccttgcagctgatgat
tcaagggtgcctaaatcttttcccatggaaatggatagcagaagtgtcaaagagagttcc
acatcatctagctcttcgattctggagtgtcagaggtccacaaagagtaatgaattgact
ttaagagcaaagcggaattctgatagtagcaatactattgctttgaccttgagtgttgct
gatccacggggtcgtcgtgggaagaagactattgagtttgatttctatcttgattccgat
actgctatttcgattgctggggagatggttgatcaggagcttggtctttcaactgaagat
gtgtcagccgtggctgagttgattgataaattggttatgaagcttgtgcccaagtggaaa
cctacttcgtctgtagcatattgctcatgtaccactactaggtcagatgctacaaagtgt
ggctgtggagctaattccggcgattcgtcaaagaactctactatctcaagcatggagata
tggaaaagctttagcacgtcaagcatttgttccttgcagtctgagtcatctccaatggac
aaacatcggtatgatcacttaaaagcggagcttgacttgattgatgcacagtatcaacaa
cgttttgttgagctggtgaagatgaaggaagaagcgatccgaagtgcaaagaagaagttg
gttggtgtagtctag

DBGET integrated database retrieval system