KEGG   Rosa chinensis (China rose): 112187733Help
Entry
112187733         CDS       T06020                                 

Definition
(RefSeq) heat shock 70 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
rcn  Rosa chinensis (China rose)
Pathway
rcn03040  Spliceosome
rcn04141  Protein processing in endoplasmic reticulum
rcn04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    112187733
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112187733
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112187733
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rcn01009]
    112187733
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rcn03041]
    112187733
   03009 Ribosome biogenesis [BR:rcn03009]
    112187733
   03110 Chaperones and folding catalysts [BR:rcn03110]
    112187733
   04131 Membrane trafficking [BR:rcn04131]
    112187733
   03051 Proteasome [BR:rcn03051]
    112187733
   03029 Mitochondrial biogenesis [BR:rcn03029]
    112187733
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rcn04147]
    112187733
Protein phosphatases and associated proteins [BR:rcn01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     112187733
Spliceosome [BR:rcn03041]
 Complex B
  Other components
   Prp19 complex
    112187733
 Complex C
   Prp19-CDC5 complex
    112187733
Ribosome biogenesis [BR:rcn03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    112187733
Chaperones and folding catalysts [BR:rcn03110]
 Heat shock proteins
  HSP70 / DNAK
   112187733
Membrane trafficking [BR:rcn04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    112187733
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    112187733
Proteasome [BR:rcn03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    112187733
Mitochondrial biogenesis [BR:rcn03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    112187733
Exosome [BR:rcn04147]
 Exosomal proteins
  Proteins found in most exosomes
   112187733
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A TarH
Motif
Other DBs
NCBI-GeneID: 112187733
NCBI-ProteinID: XP_024182404
Position
2
AA seq 654 aa AA seqDB search
MAAKTEGKAIGIDLGTTYSCVGVWQNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
QVAMNPKNTVFDAKRLIGRRFSDPSVQADMKLWPFKVIPGPGDKPMIVVHYKNEEKQFSA
EEISSMVLTKMKEIAEAFLGQTIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP
TAAAIAYGLDKKASRKGEQNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVAEFRRKHKKDISGNARALRRLRTACERAKRTLSSTSQTTIEIDSLYEGIDFY
STITRARFEELNMDLFRKCMEPVEKCLRDAKIDKSQIHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILTGEGDQKVQDLLLLDVTPLSLGLETAGGVMTTLI
PRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELTGIPPAPRGVPQI
NVCFDIDANGILNVSAEDKTAGVKNKITITNDKGRLSKEEIEKMVQDAERYKAEDEEVKK
KVDAKNSLENYAYNMRNTIKDDKIAGKLDPSDKQRIEKAVEEAIQWLEGNQLAEVDELED
KQKELEGICNPIIAKMYQGAGGAGGMPPMGDDMPGAGSGSSSATGAGPKIEEVD
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaagactgaaggaaaagcaataggcatcgacctcggcaccacctacagctgc
gtcggggtgtggcagaacgaccgcgtcgagatcatcgccaatgaccagggcaaccgcacc
actccgtcctacgtggcgttcaccgacaccgagcggctgatcggtgatgcggccaagaac
caagtcgccatgaacccgaagaacaccgtcttcgacgccaagcgtctgatcggtcggaga
ttctccgacccgtctgtacaagccgacatgaagctctggccttttaaggtcatacccggc
cccggcgacaagcccatgatcgtcgtccactataaaaacgaagagaagcagttctcggcg
gaggagatttcctccatggtgctgacgaagatgaaggagattgctgaggcctttttgggt
cagactatcaagaacgccgtggtgactgttcctgcttatttcaacgactcccaaagacag
gccaccaaggacgccggagttatatccggcctcaatgtgatgcgaatcattaacgagccg
acggctgctgctatagcatatggtctggacaagaaggcctcacggaaaggtgagcagaat
gttctgattttcgatctcggcggtggtacttttgatgtgtcacttctgactattgaggag
gggattttcgaagtcaaggccaccgccggtgacactcatctgggcggtgaggacttcgat
aatcgtatggtaaatcatttcgtggcggagtttaggaggaagcataagaaggatatcagt
gggaatgctagagctctgaggaggctgaggactgcttgcgagagggccaagaggactctg
tcttcgacttctcagaccacaattgagatcgattctctttacgaaggaatcgatttctac
tcgacgatcacgagggccaggttcgaggagctgaacatggacttgttcaggaagtgtatg
gagccggtggagaagtgtctgagggatgcgaagatcgacaagagccagattcacgacgtt
gttttggtgggtggctcgactaggattcccaaggttcagcagcttctgcaggacttcttc
aatgggaaggaactttgcaagagtattaacccggatgaggctgtggcttatggcgctgcg
gttcaggctgcgattttgaccggtgaaggtgatcagaaggttcaggatcttttgttgctt
gatgtcactcctctcagtcttgggcttgagacagctggtggtgtgatgaccactttgatt
ccgaggaacacgactattccaaccaagaaggagcagatcttctctacttattcggataac
cagcccggggttttgatccaagtttatgaaggagagagggccaggaccaaggacaacaat
ctcttggggaaattcgagctgactggcattccaccagctcctagaggtgtgcctcagatc
aatgtctgcttcgatattgatgctaatggtatcttgaatgtctcggctgaggacaagact
gctggagtgaagaacaagatcacgatcaccaatgacaagggaaggctgagcaaggaggaa
atagagaagatggtgcaggatgcagagaggtacaaggcggaggacgaggaggtgaagaag
aaggtggatgctaagaattctttggagaattatgcttacaatatgaggaatactatcaag
gatgacaagattgcagggaaattggatccttcagataagcaaaggatcgagaaggctgtg
gaggaggctattcagtggctggaggggaaccaattggccgaggtggatgagttggaggac
aagcagaaagagttggaggggatttgcaatcccattattgctaagatgtatcagggtgct
ggtggtgcaggaggtatgccacctatgggggatgacatgcctggtgctggttctggttct
agttctgcaactggagctggcccaaaaatcgaagaggttgattaa

DBGET integrated database retrieval system