KEGG   Rosa chinensis (China rose): 112190501Help
Entry
112190501         CDS       T06020                                 

Definition
(RefSeq) isocitrate dehydrogenase [NADP]-like
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
rcn  Rosa chinensis (China rose)
Pathway
rcn00020  Citrate cycle (TCA cycle)
rcn00480  Glutathione metabolism
rcn01100  Metabolic pathways
rcn01110  Biosynthesis of secondary metabolites
rcn01200  Carbon metabolism
rcn01210  2-Oxocarboxylic acid metabolism
rcn01230  Biosynthesis of amino acids
rcn04146  Peroxisome
Module
rcn_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    112190501
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    112190501
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    112190501
Enzymes [BR:rcn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     112190501
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh SET
Motif
Other DBs
NCBI-GeneID: 112190501
NCBI-ProteinID: XP_024185708
Position
1
AA seq 401 aa AA seqDB search
MMHCFHDSGDEMTRIFWKSIKDKLIFPFLELDIKYFDLGLPNRDATSDRVTIESAEATLK
YNVAIKCATITPDETRVKEFNLKQMWRSPNGTIRNILNGTVFREPIICRNVPRLVPGWTR
PICIGRHAFGDQYRATDAIIKGPGKLKSVFVPDGSNEKQEYEVFNFTGAGGVALSMYNTD
ESIRSFADASMNTAYQKKWPLYLSTKNTILKKYDGRFKDIFQEVYETHWRSRFEASSKYP
SLTDIMLAMTRKKSPSLVCNRKCQGDADGYDLVVVDAMHKATYASRICHSCRPNCEAKVT
AVDDRYQIGIYTVRKIQYGEEITLDYNSIKESKEEYEALDCLCGSQVCRGGYLNLIGEGS
FLEDRTYATYAAQDVNWIARIATLLVGEDRTQSSLILYDFT
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgatgcattgtttccatgattcaggagatgaaatgactcgaattttctggaaatctata
aaagataagcttatttttccctttctggaactggatatcaagtactttgatcttggcctc
cctaatcgtgatgccaccagtgatagagtcacaattgaaagtgcagaagctactcttaag
tacaatgtagcaatcaagtgtgcaactataactcctgatgaaactcgtgttaaggagttc
aacttgaaacagatgtggaggagtccaaatgggacaatccggaacattttaaatggtact
gtttttagagaacctattatctgcagaaatgttccccgccttgttccaggttggacgagg
ccaatatgcattgggaggcatgctttcggtgatcagtaccgagcaactgatgcaatcata
aaaggacctgggaaacttaaatcagtttttgtacctgatgggtccaatgagaagcaagaa
tatgaggttttcaactttactggtgctggaggggtagctctgtcaatgtataacactgat
gagtctatccgatcctttgcggatgcatctatgaatactgcctaccagaaaaagtggcca
ctttatcttagcactaaaaatactattctcaagaaatatgatggaagattcaaggacatc
ttccaggaagtttatgaaactcattggagatccagatttgaagcctcatcgaaatatccc
tccctgacggatattatgttggccatgacaaggaagaagagtccatctttagtctgcaac
agaaaatgtcagggtgatgctgatgggtatgatttagttgttgttgatgccatgcataaa
gcaacctatgcaagtagaatttgtcactcgtgccgacctaattgtgaagcaaaagttact
gctgtagatgatcgttaccagattggaatctacactgtacgtaagattcaatacggtgaa
gagatcacattggactacaactctattaaggagagtaaggaagaatatgaagcattagat
tgtttgtgcggcagtcaagtttgccggggaggttacctgaatttgataggcgaaggatca
ttcttggaggatcgaacatatgctacatatgctgcacaagatgtaaattggattgctcgt
attgcaacattgcttgtgggtgaggatcgaacacagtcttcattgattttgtatgatttc
acctag

DBGET integrated database retrieval system