KEGG   Rosa chinensis (China rose): 112192438Help
Entry
112192438         CDS       T06020                                 

Definition
(RefSeq) rust resistance kinase Lr10-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
rcn  Rosa chinensis (China rose)
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rcn01001]
    112192438
Enzymes [BR:rcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112192438
Protein kinases [BR:rcn01001]
 Serine/threonine kinases: TKL group
  IRAK family
   112192438
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal WAK_assoc Kinase-like
Motif
Other DBs
NCBI-GeneID: 112192438
NCBI-ProteinID: XP_024187950
Position
3
AA seq 636 aa AA seqDB search
MDILPQLKPLLFLLVFVFPITVEPISKSADDHDCPVQRCRHDGPLIQFPFRLQHYPLHCG
HPEFEVFCSRFTNTTMMKLSSSSGFFPIQTIDYEGQQFRVHDEDGCLPRRLLNFTLSSSL
FQPALLTEDSVCSYSYMTLRNMTLLNCTTAQNFSTFTTPETYDWKYIAIKCLSVPGHQVL
ATTPHFTISDLPVDACSTLSELFLPFQPIQGDYMYACELDTGLFLTWSEGKFPECQNCSG
RCYINYSSNQVLECYPPIPRLKHKGLSTSFIVMVVSVCGFVVLSTTAASIFYHLKQSIKR
KEEKENQRKIEKFLDDHKSHVPTRYSYADIKKMTNGFKKKLGEGGFGSVFSGKLPTNGVP
VAIKVLKDSEGNGDDFVNEVGTIGRIHHVNVVRLLGFSAEGGKRALIYELMPNSSLGKFI
TSRGSNKSSSSFNWEKLCNIITGIAKGIEYLHQGCDQRILHFDIKPHNILLDHAFNPKIS
DFGMAKLCSKEDSVISMTAARGTMGYIAPEVFNGNFGTVSYKSDVYSFGMLVLEVIGAMK
ETGLTSSDNEVYFPELIYKCLIQGEELDLELADDGDAQIAKRLAIVALWCIQWYPVSRPS
MKAVVRMLEGTFESLIMPPNPFASTTQMEPTTTPSS
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggatatcctgcctcagctgaagcctctgcttttcttgcttgtatttgtgttccccatt
actgttgaaccaattagcaaatcagccgatgatcatgactgcccagttcagaggtgtagg
catgatggtccccttatccagtttcccttccgtttacaacactatccccttcactgtggc
catccagagtttgaggttttctgcagcagattcaccaacacgaccatgatgaagctttcc
tcatcatcaggattctttccaatacaaacaatcgattacgagggacaacagtttcgtgtg
catgatgaggatggttgcctcccgagacgccttcttaattttactctctcctcctcgctc
tttcaaccagcacttttgactgaagattccgtttgcagttactcttacatgacgttgagg
aatatgacgttgttaaattgtacgacggcacaaaattttagcacattcaccacacctgag
acctacgactggaagtacatcgcgatcaaatgtctcagtgtcccagggcatcaagttctg
gctactactccgcactttactataagtgacttgccggtagacgcttgctctactttgtca
gaactctttcttccatttcaacctatacagggtgattatatgtatgcttgtgaactagac
actggtttatttctgacatggagtgaagggaaattcccagaatgtcagaactgcagtgga
aggtgctatatcaattacagcagcaatcaagtcttggagtgttatcctcccattcccaga
ctaaaacacaaaggtctatcaactagttttattgtcatggtagtgagtgtatgtgggttt
gttgtcttgtcaactacggcggcatccatcttttaccatttaaagcaatcaataaagagg
aaagaggaaaaggagaatcaaagaaagattgaaaagttcctagatgatcacaagtcccat
gtaccaacaagatactcctatgctgatataaagaagatgacaaatggattcaagaagaag
ttgggtgaaggaggttttggaagtgttttcagtggaaagcttcccactaatggagttccg
gtagccataaaagtcctcaaggattctgaaggaaatggagatgattttgttaatgaagtg
ggaaccattggtaggattcaccatgtaaacgtggtccgcctacttgggttttccgctgaa
ggaggcaaacgtgctcttatttatgagctcatgccaaacagttctctggggaagtttatc
acatctagaggatcaaataagagcagcagttcatttaactgggagaaactttgcaacatc
atcacaggtatagcaaagggaatcgagtaccttcaccaagggtgtgaccagaggattctc
cactttgatatcaagcctcacaatatcttgttagaccatgcctttaatccgaagatttct
gattttggtatggctaaactctgttccaaggaagatagtgttatatctatgactgctgcc
agaggcactatgggctacattgcgcctgaagtatttaatggcaactttggaactgtctcc
tacaaatcggatgtgtatagtttcgggatgctagttcttgaagttattggagccatgaag
gaaactggtcttacatctagcgacaatgaggtgtattttccggaattgatttataagtgt
ctgatccaaggagaagagttggatttggagctagctgatgatggagatgctcagattgct
aagagattagcaattgtggcactttggtgcatccagtggtacccggtgagtcgcccttcc
atgaaagcagttgttagaatgctggaaggaacctttgaaagcttgatcatgccacccaat
ccgtttgcttccacaactcagatggaaccaacaacaaccccatcaagttaa

DBGET integrated database retrieval system