KEGG   Rosa chinensis (China rose): 112192441Help
Entry
112192441         CDS       T06020                                 

Definition
(RefSeq) rust resistance kinase Lr10-like isoform X1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
rcn  Rosa chinensis (China rose)
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rcn01001]
    112192441
Enzymes [BR:rcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112192441
Protein kinases [BR:rcn01001]
 Serine/threonine kinases: TKL group
  IRAK family
   112192441
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr GUB_WAK_bind Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 112192441
NCBI-ProteinID: XP_024187957
Position
1
AA seq 670 aa AA seqDB search
MGKINLVAWVSIAALFLVIALLSGHSCNAKDEGSKSTTSSSGNIHTRSFLGVFVPKARGR
DNQKCVPSSCGHIDNISYPFRLEHDPKHCGDSSYTLECNNNVTILHLYSGEYYVKEINYR
NSTIRVVDPGLEKNNCASLPRFPLAQSNFSSLSFTYGPVSTPLTFLKCQNPVHSSLYVDT
ASCIKSEAYGYVKVGITTTSDLEDGCSIDSTTMITTFARTKRNVSYKEIHKELVYGFQLT
YEMTYIFVDCRRQGQWSSAPGRCFPHSITGFFQLLWEFIYYYIVLPLYHFDRFLLEMISI
VPVVFTVKFILGAPFVIALLIYKWRRRHSSTNNSIEDFLHSDNFMPIRYTYSNIKKMSNG
FKDKLGEGGYGSVFKAKLRSGRLGAIKLLGKPNANGEDFMSEVATIGRIHHINVVQLVGY
CVEGSKRALVYDFMSNGSLDKCIYSKEGFNTLSCKKMYEIAVGVAHGIEYLHRGCEVQIL
HFDIKPHNILLDENFIPKISDFGLAKLYPRDNSMVSSMAARGTMGYIAPELFYKNIGGVS
YKADVYSFGMLLMEMASKRKNVNALVENSSQIYFPSWVYDQYNEGKDFEIGDATTEEKQI
IKKMIITALWCIQMKPSDRPSMKRAIAMLEGDVECLQMPLKPSLCPEPMTVGNLIPTSSD
VELTCSLSAR
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaatcaaccttgtcgcatgggtttcaattgcagccttatttcttgttattgcc
ttattatctggccattcctgtaatgctaaggatgagggtagtaagtctactacttcttcc
tccggcaatatccatacaagaagttttctgggcgtatttgttcctaaagctaggggtaga
gataaccagaagtgcgtcccttcttcctgcggccacatcgacaacataagctaccctttt
cggctagaacatgatccaaagcattgtggcgactcaagctacactttggaatgtaacaac
aatgtcacaattctgcacctatattctggtgagtactacgtgaaggaaatcaactaccgt
aattccactatccgagtggtagatcctggccttgagaagaacaactgtgcttcccttcct
cgttttcctttggcccaatctaatttcagttctttgtcatttacatacgggccagtaagt
acacctctaactttcttgaagtgtcaaaatccagtgcattcttctctgtatgtggatact
gcttcatgtatcaaatccgaagcatatggttatgtcaaggtaggcattacgaccacatcg
gatttggaagatgggtgcagtatagattcgaccactatgatcactactttcgccagaacg
aagagaaatgtgtcctataaagaaatacacaaagaactggtgtatggctttcagcttact
tatgagatgacttatatctttgttgattgccggaggcaggggcaatggagctcagctcct
ggtcgatgttttccacacagcatcacaggtttctttcaacttctgtgggagttcatttac
tattatatcgtactaccactctatcactttgatcgatttttactggagatgatttccatc
gtgccagtagtttttacggtcaaatttatacttggagctccatttgtgattgcactttta
atctacaagtggcgaagaagacattcatctaccaacaactctatagaagattttctacat
agtgacaatttcatgcctataaggtacacttactccaacattaagaaaatgtctaatgga
ttcaaggataagttgggggaaggaggttatgggtctgtatttaaagcaaaattacggagt
ggccgattaggagccattaagttgttaggaaagcctaatgctaatggggaagattttatg
agtgaagtagctactattggaaggattcaccatattaatgtggtgcagcttgttggttac
tgtgttgagggttcaaagcgtgctttagtatatgatttcatgtcaaatgggtctcttgat
aaatgcatttactctaaagaaggattcaacactttaagttgtaagaaaatgtatgagatt
gcagttggagtggctcacggtattgaatatttgcatcgaggttgtgaagtgcaaatacta
cattttgatatcaagcctcacaatattttacttgatgagaattttatcccgaagatttct
gactttgggctagcaaaattatatccaagggataatagcatggtatcttcaatggcagca
aggggcacaatgggatatattgctcctgagttgttctataaaaacattggtggtgtttca
tacaaagctgatgtctacagttttggaatgttgttaatggaaatggcaagtaaaaggaaa
aatgtaaatgcattagtggagaattcaagccaaatttacttcccctcatgggtgtacgat
caatataatgaggggaaagacttcgagattggagatgctacaacagaggaaaagcaaatt
ataaaaaagatgattataactgcattgtggtgcattcaaatgaaaccaagtgatcgacct
tccatgaagagagccatagcgatgctagaaggagatgttgaatgcctacaaatgcctcta
aagccatctctatgcccagaaccaatgactgtaggcaatttgattccaacaagttcagat
gtggagctaacatgtagtttatcggcaaggtga

DBGET integrated database retrieval system