KEGG   Rosa chinensis (China rose): 112193915Help
Entry
112193915         CDS       T06020                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase-like
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
rcn  Rosa chinensis (China rose)
Pathway
rcn00601  Glycosphingolipid biosynthesis - lacto and neolacto series
rcn00603  Glycosphingolipid biosynthesis - globo and isoglobo series
rcn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    112193915
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    112193915
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rcn01003]
    112193915
Enzymes [BR:rcn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     112193915
Glycosyltransferases [BR:rcn01003]
 Glycan extension
  P blood group
   112193915
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug TcdA_TcdB
Motif
Other DBs
NCBI-GeneID: 112193915
NCBI-ProteinID: XP_024189945
Position
3
AA seq 431 aa AA seqDB search
MSPKKSSPHSTLLKMKRISQKLFHYNLFRRTAKTSIFSTISFAAIFFLLYSSDTIVSISN
LPMHPVDLKSHKIVDHRQEPTLITTTNIQEEISIDEGPDEVYDPLIPPDNVTKEERQVWF
RRKLPELEILRSNSLTQQFHSRVLQFLNNGCSIQFYMIWFSPAKSFGKREFFAMDSLFKA
HPQGCLMLLSKSMDSGRGYRILKPLLDGGFKILAVTPDLPFLVKNTPGEIWLGEMKSGRR
DPGYIPLSQNLANLIRLAVLYKYGGVYLDTDFITLKDFSGLRNAIGAQNVDLESKNWTIL
NNAVMIFDINHPLLLDFMGEFASTFNGNKWGHNGPYLVSRVTEKMGRTPGYNLTILPPEA
FYPVEWNKIRRIFRKPQKESESRWVESMLNELNEGETYALHLWNKRSRELTIEEGSVMAR
LISAHCVICRT
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgtctccaaaaaaatcctcaccccactccactctcttaaaaatgaaaagaatatcgcaa
aaactgtttcattataacctatttagacgcactgccaaaacttctattttctccaccatt
tcatttgctgccatattctttctcctatattcatcagacaccatagtctcgatctctaac
cttcccatgcatccggttgacctcaaaagtcataaaattgttgaccatcgccaggaacca
accttgattactactactaatatccaagaagagatcagcattgatgaaggtccagatgaa
gtttacgaccctctaatccctcccgataatgtaacaaaagaagaaagacaagtgtggttc
aggcggaagcttccagagctggagatactccggtccaatagcttgacgcagcaattccac
agtcgagttctccagtttctcaacaacggatgcagcattcaattctacatgatatggttt
tcaccagcgaagtcattcggaaaaagagaattcttcgccatggacagcctcttcaaagct
catcctcaaggatgtttgatgctattatcgaaaagcatggattcgggacgcggataccga
atcctgaaaccattacttgatggaggattcaaaatactcgcggtgactccagacttgcca
tttctagtcaaaaacactccaggtgaaatttggcttggcgaaatgaagagtgggaggaga
gacccaggttacatcccattgtcccaaaacctagccaatctgatcagacttgccgtgctt
tacaagtatggaggtgtatacttagacacagacttcataactctgaaggatttctcgggg
ttgaggaatgcaattggagcacaaaacgtagatttagagtccaaaaactggaccatacta
aacaatgcagtcatgatcttcgacataaaccatccgcttctactagacttcatgggagaa
tttgcttcaacatttaatggaaacaaatggggtcacaacggaccttacttggtctccagg
gtaactgagaaaatggggcgcacaccgggttacaaccttacaattttgcctcccgaggcg
ttttatccggtggaatggaataaaattcggaggattttccggaagcctcagaaggaatcg
gagtcgagatgggtggaaagcatgttgaatgagttgaatgaaggggagacttatgctcta
cacctatggaacaagagaagtagagaattgaccattgaagagggaagtgtcatggctaga
ctaatatcggcgcattgtgttatttgccggacataa

DBGET integrated database retrieval system