KEGG   Rosa chinensis (China rose): 112195389
Entry
112195389         CDS       T06020                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
rcn  Rosa chinensis (China rose)
Pathway
rcn00100  Steroid biosynthesis
rcn01100  Metabolic pathways
rcn01110  Biosynthesis of secondary metabolites
Module
rcn_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    112195389
Enzymes [BR:rcn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     112195389
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 112195389
NCBI-ProteinID: XP_024191578
Position
3
AA seq 369 aa
MDLGSLLHLLIPSWNSVAILAFFFAYLAIAGSILPGKLVPGAVLQDGSRLHYRCNGLISL
LLLAGILGAASKLEIISLTVIADRGLELLSTTFLFSFLVTLVLYAVGCKTSNRSSSLKPH
LSGNLLDDWWFGIQLNPQFMGIDLKFFFVRAGMMGWLFINLSIFARSIQEGTLSRSMVLF
QLFCALYILDYFIHEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLSNKVELR
TATVIANCFTFVIGYLVFRGANKQKHVFKKDPKAPIWGKPPRVIGGKLLASGYWGIARHC
NYLGDLLLALSFSLPCGMSSPVPYFYPIYLLILLTWRERRDEARCAEKYREIWAEYRRLV
PWRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctgggttctcttctccacctcctaattccctcttggaactccgtcgctattcta
gcattcttctttgcttacctggccattgccggatctatacttcccggaaaacttgtcccc
ggagccgtcttacaagatgggtctcgtcttcattatcgctgcaatggtctgatatcgctt
ctgctgctggctgggattctaggggctgcttccaagttggagatcatatcacttaccgta
atagcagacagaggacttgagctgttatcaaccactttcctgtttagttttctggtcaca
ctagtactttacgctgttggctgcaagacgagcaaccgcagttcttccttaaagcctcat
ctgtctgggaaccttctagatgactggtggtttggaatacagctgaaccctcagtttatg
ggcatcgacctcaagtttttctttgttagagctggaatgatgggctggctatttatcaac
ctttcaattttcgcaagaagtatccaagagggcacgttgagtcgatcaatggtcctcttc
cagttattctgtgcgttatacattctggactactttattcatgaggagtacatgacctcc
acatgggacataattgcagagagattgggcttcatgctggtatttggagatctagtgtgg
attcctttcacttttagtatccagggctggtggcttctgagtaacaaggtagagttaagg
acagccactgtcattgcaaattgcttcacttttgtgatcgggtacctagtatttagagga
gccaacaagcaaaagcatgtttttaagaaagatcccaaagcgcctatatggggtaaacct
ccaagggtcattgggggaaagttgcttgcttctggttattggggaattgcaagacactgt
aattaccttggggacttgttacttgcactgtcttttagtttaccttgtgggatgagttct
ccagtcccatatttctatccaatttatcttctaattctgcttacatggagagaaagaaga
gatgaagctcgctgtgccgagaagtatagggagatctgggcagaataccgccgacttgtt
ccatggagaattttaccctatgtttattaa

DBGET integrated database retrieval system