KEGG   Rosa chinensis (China rose): 112195416Help
Entry
112195416         CDS       T06020                                 

Definition
(RefSeq) protein HASTY 1 isoform X1
  KO
K14289  exportin-5
Organism
rcn  Rosa chinensis (China rose)
Pathway
rcn03013  RNA transport
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    112195416
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rcn03016]
    112195416
   03036 Chromosome and associated proteins [BR:rcn03036]
    112195416
Transfer RNA biogenesis [BR:rcn03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    112195416
Chromosome and associated proteins [BR:rcn03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     112195416
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xpo1
Motif
Other DBs
NCBI-GeneID: 112195416
NCBI-ProteinID: XP_024191614
Position
3
AA seq 1206 aa AA seqDB search
MEASNNSSSNLAGSVAQAIAVSLDWSSTPDARKAAVAFLESIKTGDVRVLANTAFLLVKK
DWSSEIRLHAFKMLQHLVRLRWEELNPTEHRNFANVTVDLMSEIANPNEEWALKSQTAAL
VAEIVRSEGVDLWQELLPTLVSLSAKGPIQAELVSMMLRWLPEDITVHNEDLEADRRRLL
LRGLTLSLPEILPLLYNLLERHFGAAMSEAGKQQVDLAKQHASAVTATLNAVNAYSEWAP
LPDLAKYGIIHGCGFLLSSPDFRLHACEFFKLVSPRKRHVDTSTPEFDSAMSTVFHILMN
ASKEFLYSSGVNAGVIDESNIEFAEYLCESMVSLGSTNLQCIVGDSTTLPLYLQQMLGFF
QHHKLVLHFQSLNFWLALMRDLMSKPPKSKVAAHSSADGSDQADKEKQKILSFVNDDICS
ALLDVSFQRLLKREKILHGTSISLGSLELWSDDVDSKGTFGQYRSKLLELIKFVTSYKPV
IAGAKVSERIDTIIKSLLLSPMPAQDLAVMESMQSALENVVSTIFDRSNEIGGGHSEVQL
GLCRIFEGLLQQLLSLKWTEPVLVEVLGHYLDAMGPFLNYFPDAAGSVINKLFELLNSLP
FAVKDPSTSSARYARLQICTSFIRIAKTADKSILPHMKGIADTMAYLQKEGRLLRGEHNL
LGEAFLVMASAAGFQQQQEVLAWLLEPLSQQWVQIEWQNNYLSEPLGLVRLCMETPTMWS
VFHCITFFEKALKRSGTRKTHLSSQNNSAASSTPLHPMASHLSWMLPPLPKLLRAIHSLW
SPSVSQTLPGEMKAAMTMSDVEQYSLLGEGNPKLSKGTLTSGPGSLVTMSKEGYTEPNES
DIRNWMKGIRDSGYNVLGLATTVGDTFYKCLDSHSVALALVENIQSMEFRHIRPLVHSVL
IPLVKNCPVDLWEVWLEKLLHPLFLHSHQALCCSWSSLLQEGRAKVPDVHAILAGTDLKV
EVMEEKLLRDLTREICSLLSAIALPQLNTGLPSLEHSGQISRVDLSSLKSLDSFASSSMV
SFILKHQGLALPALQICLEAFTWTDGDAMTKVSSFCGALVVLAIFTNSVELQQFVCKDLF
SAIIQGLALESNAFISADLVGHCRDIYIYLCDRHPAPRQILLSLPCIKQHDLLAFEEALT
KTASPKEQKQYMKSLLLLATGNKLKALVAQKTVNVITNVSAKPRNTVNVAETRVDEGEVI
GLAALS
NT seq 3621 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgagcaacaatagcagcagcaacctagctggcagcgttgcccaagccattgcc
gtctctctcgactggagctccacgcccgacgctcgcaaagccgccgtggcttttcttgaa
tcgattaaaactggagatgtgcgtgttttggcaaatacagcgttccttctagtgaaaaag
gattggtcttctgaaattcggttgcatgcatttaaaatgttgcagcatttggtccggttg
cggtgggaggaactaaaccctacagaacatagaaactttgctaatgtcactgttgatcta
atgtctgaaattgcaaatcctaatgaagagtgggctttgaaaagtcagacagcagcactt
gttgctgagatagttagaagtgaaggagtagatctctggcaggaactgcttccaactctg
gtttccttatctgcaaagggtcctatacaagctgagttggtctccatgatgctgaggtgg
cttcctgaagacattactgttcacaatgaagatttggaagctgatcggagaaggctattg
ttgcgtgggctgaccctatccttacctgaaattttacctctattatacaacttgctagag
aggcattttggagctgccatgagtgaagcagggaaacaacaagtggaccttgcaaaacaa
catgcatctgcggtaacagctactttaaatgctgttaatgcatattctgaatgggctcca
ttgcctgatcttgctaaatatggtataattcatgggtgtggtttcttactttcttcacct
gacttccgtcttcatgcttgtgagtttttcaaacttgtttccccaagaaagagacatgtt
gatacatcgactcctgaatttgattctgcaatgagtactgtctttcatattttaatgaat
gcctccaaagaatttttgtacagctctggcgtcaatgctggggtgattgatgaaagcaat
attgaatttgcggaatatttatgtgaaagtatggtgtctttgggttcaacaaacttgcaa
tgtatcgtgggtgatagcaccacattacctctttatttacaacagatgctcgggtttttt
caacatcataagctagttcttcattttcaatctctcaatttttggctggcacttatgaga
gacttaatgtctaagccacctaagtcaaaggtggctgcacactcatcagctgatggttct
gaccaggctgataaggaaaagcagaagattttgagttttgtgaacgatgacatatgtagt
gcacttctggatgtatctttccaacgattgctcaagagagaaaagattcttcatggaaca
tcaatctctttggggtcattggagttatggagtgatgatgttgacagcaaaggaactttc
ggccagtatcgctcaaagctgttggaactgatcaagtttgttacctcatacaagcctgtt
atagctggtgctaaggtttctgaaagaattgatacaatcattaaaagcctcttgctttct
ccaatgcctgctcaggacttagctgtgatggaaagcatgcagtcggctcttgaaaatgtt
gtaagcactatttttgatagatcaaatgaaattggtgggggccattctgaagttcaacta
ggactatgcagaatattcgaaggtttgcttcagcaacttctctctttgaagtggactgag
ccagtccttgtggaagtacttggtcactacttggatgcaatgggtccatttttgaactat
ttcccagatgcagcaggcagcgtcatcaataaactatttgagctcctaaactcactccct
tttgctgttaaggatccctctacaagtagtgcacgatatgcaaggttgcaaatttgtaca
tcgtttattcgtatagcaaaaactgctgacaaaagtattcttcctcacatgaagggtata
gctgataccatggcatatttgcaaaaggaaggtcgtttacttcgtggtgaacataatctt
ctaggcgaagcatttcttgtcatggcttctgctgctggatttcaacagcagcaagaagtt
ttggcctggttactagaacccttgagccagcaatgggtacagatagagtggcaaaataat
tatttatctgaaccactaggtcttgttcgtttgtgcatggagaccccaactatgtggtca
gttttccactgtatcacattctttgagaaggcacttaagagaagtggaacccggaaaaca
catttgagttcacaaaacaactcagccgcaagttctactcccttgcatcctatggcttct
catctatcatggatgctgccacctcttcccaaacttcttcgtgccatacattccctttgg
tctccatctgtatctcaaactctacctggagaaatgaaagctgcaatgaccatgagcgat
gttgagcaatacagtcttcttggtgaaggaaaccctaaattgtcaaagggtacattaacc
tctggtcctggatctcttgtcaccatgagtaaggaaggatatacagagccaaatgaatcg
gatatacgaaattggatgaaagggatcagagacagtgggtacaatgtattgggcctggca
accactgttggggacacattctacaaatgtttggacagtcattctgttgctctagctttg
gttgagaatatacagtcaatggaattcaggcatataagaccgcttgttcattcagttttg
attcctttggttaaaaattgccctgtggatttgtgggaggtatggctggaaaagctcttg
cacccattatttctacactcccatcaggctctttgttgctcctggtccagtcttctacaa
gaaggtagagcaaaggttccggatgtccatgccattcttgctgggacagacttaaaagtg
gaagtaatggaagaaaagctactaagagatcttactcgagagatttgttcactcctctct
gccattgctttgccacagctaaatactggccttccatccttggagcactctgggcaaatc
agccgagtcgatctatcttcactcaagtctttagattcttttgcatcgagctctatggtt
agtttcattttgaagcaccaaggtcttgcccttccagcactgcagatatgtttagaagct
tttacatggacagatggtgatgccatgacaaaagtttcttccttttgtggtgctttggtt
gttctagctatattcacaaatagtgtggaactccaacagtttgtttgtaaggatctcttt
tctgcaattattcaaggtttagcccttgaatcaaatgctttcatcagtgctgatttggtt
ggtcattgccgtgacatttacatatatctttgtgatagacatcccgctccgaggcagatt
ctgctctcacttccctgcatcaaacagcatgatttgcttgcttttgaagaagctttgacg
aagacagctagtcctaaagagcaaaaacaatatatgaaaagcctgctattattagctacc
ggaaacaagttaaaagcacttgttgctcagaaaactgtaaatgttataacaaatgtatca
gcaaagcctcgcaacacagtcaacgttgcagaaaccagagttgatgagggggaagttatt
ggactggcagccctatcatga

DBGET integrated database retrieval system