KEGG   Rosa chinensis (China rose): 112196075Help
Entry
112196075         CDS       T06020                                 

Definition
(RefSeq) putative receptor-like protein kinase At4g00960 isoform X1
Organism
rcn  Rosa chinensis (China rose)
Brite
Enzymes [BR:rcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112196075
Protein kinases [BR:rcn01001]
 Serine/threonine kinases: TKL group
  IRAK family
   112196075
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Stress-antifung DUF3403 Pkinase_fungal Haspin_kinase APH OAD_gamma TMEM154 TMEM51 RIFIN PRIMA1 LRR19-TM Kdo
Motif
Other DBs
NCBI-GeneID: 112196075
NCBI-ProteinID: XP_024192135
Position
1
AA seq 545 aa AA seqDB search
MVRYSNRSFHLELSPSYNQSTTRNLSSSDVDSFNVDSFNSELEGLIRGMKYQAAAGGLQK
KFATEKRRVMYSNNQSIFGKVQCIPDLSEEECGVCLDEGLRQLQKCCYGMDSATFGNPSC
NLMYEVFTSDDPAEYGEPRTLSHPTPPSAKNLGGNKKSSTSAGTVIIIAMATVVSFLILI
MSICIYLRVKYKRKRIEERAEEMKSAEALQFDFRSIRAATNNFSEANKLGRGGFGIVYSG
ILPDDKDIAVKRLSRDSAQGDLEFKTEVSLVARLQHRNLVRLLGFCLGKNEKILVYEFVP
NGSLDQFIFGEVKRAHLDWDVRYKIIVGIARGLLYLHEDSRLKIIHRDLKASNILLDADM
NPKIADFGMARLFDLDQSQGETRRVVGTYGYMAPEYVMRGQFSVKSDVFSFGVLVLEIVS
GQKNSSFRNRGNVEDLLSYAWKNWRADTASNIIDPILSSGSRTEMMRCINIGLLCVQQNI
ADRPTMTSVILMLTGNSLTLPVPSQPAFFMGASDFSKVVELDQAQSSSSVQKSVNEASIT
ELSPR
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggtacgctactccaaccgctcctttcatcttgagctttctcctagttacaatcaatcg
accacgagaaacctatcgtcgtcggatgtcgattcattcaatgtcgattcattcaattct
gagctggaggggttaatcagaggaatgaaatatcaagcagctgcaggtggtcttcagaaa
aagtttgcaacggaaaagagaagggttatgtattccaacaatcaatcaatatttggtaaa
gtacagtgcattccggacttgtcggaggaagagtgcggtgtctgcttggatgagggtctg
agacagcttcagaaatgttgttatgggatggattctgcgacatttggtaatccgagctgt
aatttgatgtatgaagttttcacctccgatgatccagctgaatatggtgaaccacgaaca
ctatctcatcctactccgccatcagctaaaaatttaggaggaaataagaagagcagcaca
tctgcagggaccgtcatcattattgctatggcaacggttgtttccttcttgattctaatt
atgtccatctgcatctatctgagagtgaagtataaaaggaaaagaattgaagaaagagca
gaagaaatgaaatctgcggaagctttgcaattcgactttcgctccattagagctgccaca
aataacttttcggaagcaaataaacttggacggggagggtttggtattgtttacagtggt
atacttcccgatgataaggacatagcggttaaaaggctttcgagggattctgcacaagga
gatttagaattcaaaactgaggtctcgctagtggccaggcttcaacataggaatttggtt
aggcttcttggtttttgcttgggaaaaaatgaaaagattcttgtttatgagtttgtccct
aacggaagtcttgatcaattcatatttggtgaagtcaagcgcgcacatttggattgggat
gttcgctacaaaatcatagtaggcattgcgagagggctcctttacctccatgaagattct
cgtcttaaaatcattcaccgtgatctcaaagctagcaacattctattagatgcagacatg
aaccccaaaattgcagattttggtatggcgagattgtttgatcttgatcaatcacaaggc
gaaaccagacgagttgtgggaacttacggatatatggctccagagtatgtgatgcgtgga
caattttcggttaagtctgatgtctttagctttggtgtcttagttttggagatagtaagt
ggacaaaagaatagttcttttcgtaatagaggaaatgtggaggatcttctaagctatgca
tggaaaaattggagagcagatacggcttcaaatataatagatcccatcttgagttctggt
tcaagaactgagatgatgagatgcatcaacattggattgttatgtgtgcaacaaaatata
gctgataggccaactatgacttcagttattctcatgctcactggcaactctctcactctt
ccagtaccctcacagccagcattttttatgggtgcatccgacttttcaaaggttgtagaa
ttggatcaagctcaaagcagcagttctgtccaaaaatctgttaatgaggcttcaattact
gaactatcacctcgctaa

DBGET integrated database retrieval system