KEGG   Rosa chinensis (China rose): 112196213Help
Entry
112196213         CDS       T06020                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
rcn  Rosa chinensis (China rose)
Pathway
rcn03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    112196213
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rcn03041]
    112196213
Enzymes [BR:rcn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     112196213
Spliceosome [BR:rcn03041]
 Complex C
  Other components
   Step II factors
    112196213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 AAA_19 AAA_30 T2SSE ABC_tran Sigma54_activ_2 PhoH AAA_16
Motif
Other DBs
NCBI-GeneID: 112196213
NCBI-ProteinID: XP_024192293
Position
4
AA seq 1190 aa AA seqDB search
MAAIDDGLKKLEYLSLVSKVCSELETHLGFGDKVLAEFITEMGRNCGNVDEFDAKLKENG
AEMPDYFVRTLLTIIHAILPPKPKSENDSMIDSTTEGKKTKFKALSIADNRDRVNDLQRE
IEMETKEKKSDREEWGDEREEDRRRGRGRDRDRYGERDRDRDRDRDRRERGRDRYDRDER
RRDTHHDYDKGRHTDRSNKHRRDGYQEDEDVREDGGNRRGGGDQRSGLHHSDEPELYQVY
KGRVSKVMDTGCFVQFSDFRGKEGLVHVSQMATRRIGNAKDVVKRDQEVYVKVISVSGQK
LSLSMRDVDQHTGKDLLPLKKSSEDDAHRTNPSVSKHDGPVTRTGLSGIRIVEENNVAPS
RRPLKRMSSPEKWEAKQLIASGVLGVTEYPMYDEETEGMLYEEEGAEEELEIELNEDEPA
FLQGQSRYSVDMSPVKIFKNPEGSLSRAAALQSALIKERREVREQQQRTMLDSIPKDLNR
PWEDPMPETGERHLAQELRGVGLSAYDMPEWKKDAFGKTVSFGQRSKLSLQEQRQSLPIY
KLKKELVQAVHENQVLVVIGETGSGKTTQVTQYLAEAGYTTMGKIGCTQPRRVAAMSVAK
RVAEEFGCRLGEEVGYAIRFEDCTGPDTVIKYMTDGMLLREILIDENLSQYSVVMLDEAH
ERTIHTDVLFGLLKKLIKRRPDLRLIVTSATLDAEKFSGYFFDCNIFTIPGRTFPVEILY
TKQPESDYLDASLITVLQIHLTEPEGDILLFLTGQEEIDFSCQSLFERMKGLGKNVPELI
ILPVYSALPSEMQSRIFDPAPPGKRKVVVATNIAEASLTIDGIFYVIDPGFAKQNVYNPK
QGLDSLVITPISQASAKQRAGRAGRTGPGKCYRLYTESAYRNEMSPTSVPEIQRINLGLT
TLTMKAMGINDLLSFDFMDPPSPQALISAMEQLYSLGALDEEGLLTKLGRKMAEFPLDPP
LSKMLLASVDLGCSDEILTMIAMIQTGNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAV
YEAWKAKNFSGPWCFENFVQSRSLRRAQDVRKQLLSIMDKYKLDVVSAGKNFTQIRKAIT
AGFFFHGARKDPQEGYRTLVENQPVYIHPSSALFQRQPDWIIYHELVMTTKEYMREVTVV
DPKWLVELAPRFFKVADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA
NT seq 3573 nt NT seq  +upstreamnt  +downstreamnt
atggctgccattgatgatggtttgaagaagctcgagtacctttccttggtttccaaagtc
tgttcagagctggaaacccatctagggtttggggataaagttcttgctgagttcataact
gagatgggacgaaactgtgggaacgtggatgaatttgatgccaaattgaaggagaatggt
gccgagatgcccgattactttgtccgcacactcctcactatcattcatgcaattcttcct
ccgaagccaaagtctgagaatgactcaatgatagacagtactactgaaggtaagaagacc
aagtttaaggctctgtctattgctgataacagggatagggtaaatgatctccagagggaa
attgagatggagaccaaagaaaagaaaagtgaccgagaagagtggggtgatgagcgtgaa
gaagataggcgtagaggtagaggtagagatagagacagatatggggaaagggatcgagac
agagatagagatagggataggagagagaggggcagggataggtatgacagagatgagagg
cgtagagatacacatcatgattatgataagggaaggcatacagaccgatccaataagcac
agaagggatgggtatcaagaggatgaagatgttagagaagatggtggtaacaggagagga
ggtggggatcagcggagtggactgcaccattctgatgagcctgaattgtatcaggtttat
aagggcagggtatcaaaagtcatggacacgggttgctttgttcagttcagtgactttagg
gggaaggagggtttggttcatgtttcacagatggcaacacggcgtattggtaatgctaaa
gatgtggtgaagagggatcaagaggtctatgttaaggtgatttcagtttctggtcagaag
ttgagcctttcaatgagggatgttgatcagcataccggaaaggatttgcttccattgaag
aagagctcagaggatgacgctcataggacaaacccttcggtatcaaagcatgatgggcct
gtgacaaggactggtctttctgggattagaattgtggaagagaacaatgttgccccttct
cggcggccattaaagagaatgagctcgccggagaagtgggaagccaaacagttgattgcc
tcaggtgttttgggggttacagaatatccaatgtatgatgaggaaacagaggggatgctt
tatgaagaagagggagctgaggaagagcttgaaattgagcttaatgaggatgagccagcc
tttttgcaagggcaaagcaggtattctgtagatatgtcacctgtgaaaatctttaagaat
ccagaggggtcattaagtcgtgcagctgcacttcaatctgcacttattaaagagcgcaga
gaagtgcgtgagcagcagcaaagaaccatgttggattcaatcccaaaggatctgaatcgt
ccctgggaagatccaatgccagagactggtgagaggcatcttgcacaggagcttagaggt
gttggtttgtcggcctatgacatgcctgagtggaagaaggatgcttttgggaagactgtt
agttttgggcagaggtcaaagctctcacttcaggaacagaggcagagcttgcctatctac
aagctcaagaaagaattggttcaggcagtgcatgaaaatcaagttcttgttgtcattggt
gagactggttcgggcaagacaacccaggtaacacaatatcttgcagaagcaggttacaca
acaatgggtaagattgggtgtacacaaccacgtagggtggctgcgatgtctgtagccaag
agagttgctgaagaatttggttgtcgtttgggggaggaagttggctatgctattcgtttt
gaggattgcactggccctgatactgtcatcaagtacatgactgatggtatgcttcttagg
gagattttgatcgatgaaaacctttctcagtactctgtggtcatgcttgatgaagctcat
gagaggacaatccatacagatgttctttttggattattgaagaaacttatcaagcggaga
ccagacctacgtttaattgtcacatctgctaccttagatgctgagaagttttcaggttat
ttcttcgactgtaacatcttcactataccggggagaacttttcctgtagagatactatac
accaagcagccagaaagtgattatcttgatgcatctctaatcactgttctacagattcac
ttaacagaaccagaaggggatatccttctcttcttgacgggacaggaagaaattgatttc
tcatgccagtcactttttgagaggatgaaaggtcttggtaaaaatgtacctgagttgatt
atcttaccagtttacagtgcccttcctagtgaaatgcagtcgaggatttttgatccagct
ccacctgggaagaggaaagtagttgtggctactaatattgctgaggcatcactaaccatt
gatgggatattttatgtaattgatcctggatttgcaaagcaaaatgtttataacccaaag
caagggctggattcactggtcataaccccaatttcacaagcatcagccaagcaaagagct
gggcgcgctgggcgtactgggcctggaaagtgttaccgcctctacactgagagtgcatac
cgcaatgagatgtcccctacttcagttccagaaattcagaggataaatcttgggttaact
acacttaccatgaaagcaatggggataaacgatctgttgtcttttgattttatggatcct
ccgtcaccccaagcactcatttctgctatggaacaactgtacagtttaggagcactcgat
gaggaggggcttctcaccaaactgggtaggaaaatggctgagtttcctcttgatccacca
ctatctaagatgctactggccagtgtggaccttggatgcagtgatgagatcttgaccatg
attgccatgattcagacaggcaatatattttacaggcctagggaaaaacaagcccaggct
gatcagaagagagccaagtttttccagccagagggagaccatctgactttacttgcagtg
tatgaggcttggaaagctaagaacttttcagggccatggtgctttgagaacttcgttcag
tctcgatcccttaggagggcacaggatgtcagaaaacagcttctaagcatcatggataag
tataaactggatgttgtgagtgctggaaagaattttacacagatcaggaaggcaattacg
gcgggatttttcttccatggtgctagaaaggaccctcaggaggggtatagaaccttagtg
gagaaccagccagtttatatccatccaagcagtgcgctcttccagagacaaccagattgg
atcatctaccatgagttggttatgactacgaaggagtatatgcgtgaggtaaccgtcgtt
gaccccaaatggcttgtggaactagcacccaggttcttcaaagtggcagaccctaccaag
atgagtaagcgcaagcgtcaagagcgtattgaaccgctatatgacagataccatgaacca
aactcttggcgtcttagtaaacgacgtgcatga

DBGET integrated database retrieval system