KEGG   Rosa chinensis (China rose): 112197244Help
Entry
112197244         CDS       T06020                                 

Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase At5g24080
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
rcn  Rosa chinensis (China rose)
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rcn01001]
    112197244
Enzymes [BR:rcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112197244
Protein kinases [BR:rcn01001]
 Serine/threonine kinases: TKL group
  IRAK family
   112197244
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 112197244
NCBI-ProteinID: XP_024193632
Position
4
AA seq 297 aa AA seqDB search
MDNFLNDMEREKPVRFTSLQLRIATDNFTNLLGSGGFGSVYKGESSNGTLVAVKALSGTS
DKRIDEQFMAEVSTLGRIHHVNLVRLHGFCFERHLRALVYEYMSNGSLDKFLFHGNKILR
FEKLHEIAVGTARGIAYLHEECQQRIVHYDIKPGNILLDVNFFPKVADFGLAKLCNRDNT
HISMTGGRGTPGYAAPELWLGLPITHKCDVYMYIFRLMLLFEIIGRRRNLDLNLPESQDW
FPRWGWKKFEAGELGQLMVVCGIEEKDREAVESNVLKRGGVPEAFSGEPHQGVSLEA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggacaattttctaaatgatatggaaagagagaagcccgtcaggtttacttctctacaa
cttcggattgcaactgataacttcaccaacttgttgggttcaggagggtttggttcagtt
tataaaggtgaatctagtaatggaacacttgtggcagtgaaggctctaagtggtacctcg
gacaagagaattgatgagcaattcatggcggaagttagtacacttggcaggattcatcat
gtcaacttggttcgtctccatggtttctgctttgagagacacctcagagcgcttgtttat
gagtatatgtcaaatggttcgcttgacaagtttcttttccatggaaacaagattttaaga
ttcgaaaagcttcatgaaattgcagttgggacagctagagggattgcttacttgcacgaa
gaatgccagcagcgaatagtccactacgatataaaacctggaaatattcttttagatgtg
aatttcttccctaaagttgctgatttcggtttggccaagctgtgcaacagggacaatact
catatatcaatgacaggtgggaggggaactcctggttatgctgcaccagaactttggctg
gggcttcctataacccacaaatgtgatgtgtacatgtacatctttagattaatgctgtta
ttcgagattataggtagaagaagaaaccttgaccttaatcttccagagagccaagactgg
tttccaaggtggggatggaagaagtttgaagctggtgaactaggacaactaatggtagta
tgtggtatagaggaaaaagatagagaggcagtagagagcaatgttttaaaacgcggaggc
gtacctgaggcgttttcgggagagcctcaccaaggcgtaagccttgaggcataa

DBGET integrated database retrieval system