KEGG   Rosa chinensis (China rose): 112198817Help
Entry
112198817         CDS       T06020                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
rcn  Rosa chinensis (China rose)
Pathway
rcn03040  Spliceosome
rcn04141  Protein processing in endoplasmic reticulum
rcn04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    112198817
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112198817
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112198817
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rcn01009]
    112198817
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rcn03041]
    112198817
   03009 Ribosome biogenesis [BR:rcn03009]
    112198817
   03110 Chaperones and folding catalysts [BR:rcn03110]
    112198817
   04131 Membrane trafficking [BR:rcn04131]
    112198817
   03051 Proteasome [BR:rcn03051]
    112198817
   03029 Mitochondrial biogenesis [BR:rcn03029]
    112198817
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rcn04147]
    112198817
Protein phosphatases and associated proteins [BR:rcn01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     112198817
Spliceosome [BR:rcn03041]
 Complex B
  Other components
   Prp19 complex
    112198817
 Complex C
   Prp19-CDC5 complex
    112198817
Ribosome biogenesis [BR:rcn03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    112198817
Chaperones and folding catalysts [BR:rcn03110]
 Heat shock proteins
  HSP70 / DNAK
   112198817
Membrane trafficking [BR:rcn04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    112198817
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    112198817
Proteasome [BR:rcn03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    112198817
Mitochondrial biogenesis [BR:rcn03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    112198817
Exosome [BR:rcn04147]
 Exosomal proteins
  Proteins found in most exosomes
   112198817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl StbA
Motif
Other DBs
NCBI-GeneID: 112198817
NCBI-ProteinID: XP_024195690
Position
4
AA seq 294 aa AA seqDB search
KASLSAEEISSMVLAKMREIAEAYLGSTVKNAVITVPAYFNNSQREATKKAGITAGLNVM
RIINEPTAAAIAYGLDKKAGWYSKRNVLIFDLGGGTLDVSLLTIGDGVFEVKATAGDTHL
GGEDFDTKMVNYCVVEFKRKHNFDVSGNSRTLRRLRNACEKAKRRLSFTTTTDIEIECLH
QGIDFCVTFTRAKFEQLNLDFFNKCMEPVEKCLEDAKMDVGSVHDVVLAGGSSRIPKVQQ
LLQNVFKGKELCKSINPDEASCSSCSLDRWELAWETTRLHSLGCHPSLTWSGLY
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
aaagcttcactctctgctgaagagatatcaagtatggttcttgcaaaaatgcgggagatt
gctgaagcctatcttggatcaactgtgaagaatgcagtgatcacggtccctgcttacttc
aataattcacagcgtgaggcaacaaaaaaagctggtattactgcaggtctaaatgtgatg
cgtatcatcaatgaaccaactgcagcagccattgcttatggcctggacaagaaggctggt
tggtatagcaagagaaatgtactcatatttgatttgggtgggggtactttagatgtgtca
ctacttacaataggtgatggtgtctttgaagtgaaagccactgctggagatactcatctt
ggaggtgaggacttcgataccaaaatggtgaattactgtgttgtggaatttaagaggaag
cacaattttgatgtcagtggaaacagcagaactcttaggaggttaagaaatgcatgtgaa
aaggcaaagaggagactttcatttacaactacaactgacatcgaaattgaatgtttgcat
caaggtattgatttctgtgtgacttttactcgtgccaaatttgaacagctcaaccttgat
ttctttaataagtgtatggagcctgtggagaagtgtttggaggatgccaaaatggacgtt
ggtagtgtccatgatgtcgttcttgctggtggctcttctagaattcccaaggtgcaacaa
ctgctacagaatgtgttcaaggggaaggagctgtgcaagagcataaatcctgatgaggca
agctgttcaagctgcagtcttgacaggtgggaacttgcatgggaaactacaagacttcac
tctcttggatgtcacccctctctcacttggagtggactgtactga

DBGET integrated database retrieval system