KEGG   Rosa chinensis (China rose): 112203163Help
Entry
112203163         CDS       T06020                                 

Definition
(RefSeq) probable polygalacturonase At3g15720
  KO
K01184  polygalacturonase [EC:3.2.1.15]
Organism
rcn  Rosa chinensis (China rose)
Pathway
rcn00040  Pentose and glucuronate interconversions
rcn01100  Metabolic pathways
Module
rcn_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:rcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    112203163
Enzymes [BR:rcn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.15  endo-polygalacturonase
     112203163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_28 Pectate_lyase_3 PITH Beta_helix
Motif
Other DBs
NCBI-GeneID: 112203163
NCBI-ProteinID: XP_024199938
Position
1
AA seq 475 aa AA seqDB search
MEGRILATMFLFMIIMVASPSPSSCARLNGFPTTYTLRDDGAIGYYGDQVAAATSNSFHD
KEYGDVFATPNTFKEYYRPLANRQTDDDLQAFPDAWRSLAKSEFNVMNYGAVGNGQVDDT
QAFLKAWGDVCGSTQGLPALIIPKGNTFLLNSVEFKGPCKAASVNFQLSGNIVAPNNINA
WKDKEKWIQFYDVEGLIINGGGQIDGQGEVWWKVCDNSNCQRPTSVLHIYQCDGLRLSDI
THINSPRNHIFIMGSNGVQISDILIRAPDESPNTDGIKISRSTNINIHNSFIGTGDDCIA
IISGSSHINITNVMCGPGHGISVGSLGKEGAYNTVEDVQVRNCTLKGTDNGARIKTWQGG
SGYARNISFEDIIIQEVKNPIIIDQKYIDKSIAGTGTLLGQGSAVKVSDVTFRNIRGSVA
GETAITLDCDDQIGCKNIVMDNIDLTSSVPGKKVSAQCKNVQGFSTSLSPSVPCL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggagggtcgaatacttgctacgatgtttttgttcatgatcattatggttgcttcacct
tcaccaagttcatgtgccagacttaatggttttcccacaacatatactttaagagatgat
ggtgccattggttattatggtgatcaagttgctgctgcgacatcaaattcatttcatgat
aaggagtatggtgatgtttttgcaaccccaaatacattcaaagagtattatcgtcctctt
gcaaatcgccaaaccgatgatgatttacaagcattcccagatgcatggagatcacttgca
aaaagcgaattcaatgtgatgaattatggcgctgttgggaatggccaagttgatgataca
caagcctttctaaaagcatggggagatgtttgtggatccactcaaggcctccctgcactt
attataccaaagggcaacactttcttgctcaattctgtggagtttaaaggaccttgcaag
gctgcaagtgtaaatttccagctaagtgggaacattgttgcaccaaataatataaatgct
tggaaagacaaggagaaatggattcagttttatgatgttgaagggctgataatcaatgga
ggaggtcaaattgatggtcaaggtgaggtttggtggaaagtttgcgacaattcaaattgc
caacgaccaacatctgttctccatatttaccagtgtgatggtctccgcttgagtgatatt
acacatattaatagtccgagaaaccatatattcatcatgggcagcaatggcgttcaaatt
tcagatatccttattagggctcctgatgaaagtccaaacactgatggaattaaaatctct
agatcaaccaacattaacattcacaattcttttataggcactggtgacgactgtattgca
atcatttctggttcatctcatatcaacattactaatgttatgtgtggtccaggccatggt
ataagtgttggaagtcttggtaaggaaggtgcttataacacagtggaagatgtgcaagtg
agaaactgcaccctgaagggaacagataatggagcaagaatcaagacatggcaaggcggg
tcagggtatgctaggaacatcagttttgaggatatcataattcaagaagtcaagaacccc
atcattatagaccagaagtatattgataagagcattgctggaactggaaccttgcttggc
caaggaagtgctgtaaaagtgagcgatgtgacattccgtaacattcgaggatctgttgct
ggggaaacagccattactttggactgtgacgatcaaattggttgcaaaaacattgtaatg
gataacatagacttgacttcatctgttcctggcaagaaggtttctgcccagtgcaagaac
gttcaaggattttctacttcattatctcctagtgtgccatgcctttaa

DBGET integrated database retrieval system