KEGG   Rickettsia conorii: RC0062Help
Entry
RC0062            CDS       T00061                                 

Gene name
aco1
Definition
(GenBank) acyl-CoA desaturase 1
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
rco  Rickettsia conorii
Pathway
rco01040  Biosynthesis of unsaturated fatty acids
rco01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rco00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    RC0062 (aco1)
Enzymes [BR:rco01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     RC0062 (aco1)
Lipid biosynthesis proteins [BR:rco01004]
 Desaturase
  First
   RC0062 (aco1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase efb-c PRESAN Dna2
Motif
Other DBs
NCBI-ProteinID: AAL02600
UniProt: Q92JK5
Position
complement(54469..55662)
Genome map
AA seq 397 aa AA seqDB search
MLSKLNKPALFALIFYPIFIISLVVKYSFDYGIGLTEVIFIIASYYINNITVGIGLHRLW
SHNAYKINKYAEFVLIMLSAGTLQGPALSWASNHYKHHRYTDQDQDPHTPLKFDNKFLGF
MWSHIGWMLVGSGSYKSIDRITWAKHGKNNLLKWQLKYYWQIAAFMNIVVPLFIGYLVGG
TMQSAYAGFLFMGLGRFLQQQATFCVNSLCHFAGSKKYYKGTAGDIWWMALFLLGENWHN
YHHAFPSDYRNGAKWYHLDVHKWIIFLMSKIGLASELERTTKVRIQAKMQETLNYLSEKQ
KQKLTLMQTKIDHLLENLCLKIKELEESSITIKEQFKKSFVEIQESLKNLAEQVSAATQI
TEKSSEKLLKIVNKKIIDAEQSIYKLYNQLNTLKVSH
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtaaactaaataagcccgctttatttgctttaatattttatcctatttttatt
atatctcttgtagttaaatattcgtttgattatggaatagggctaactgaagttattttt
ataattgctagttattatattaataatattaccgttgggatcggtctgcataggttatgg
tctcataatgcctataaaataaataaatatgccgagtttgtcttaattatgctgtctgca
ggaacattacaaggaccagctttatcttgggcatcgaatcattataaacatcatagatat
acggatcaagaccaagatccacatactcctttaaaatttgataataaatttttaggcttt
atgtggtctcatataggatggatgctagtcggaagcggtagctataagtctattgatcgc
attacttgggctaagcacgggaaaaacaatttattaaaatggcagctaaaatattattgg
caaatagcagcttttatgaatattgtcgtgcctttatttatcggttacttagtcggtggt
actatgcaatcggcatatgcaggatttttatttatggggctcggtagattcctacagcag
caagcaaccttctgcgttaattctttatgccactttgccggtagtaaaaaatattacaaa
ggcactgctggagatatttggtggatggcattattcttactcggtgaaaattggcataat
taccatcatgcttttccttcagattatcgtaacggtgcaaaatggtatcatttggacgtt
cacaaatggataatatttttaatgagtaaaatcggtttagcttcagaacttgaacgtact
acaaaagtacgtatacaggcaaaaatgcaagaaactttaaactatcttagtgaaaaacaa
aagcaaaaattgactttaatgcaaactaaaatagatcatttattagaaaatctatgctta
aaaattaaagagcttgaagaatcatctattactatcaaagaacaatttaaaaaatctttt
gtagaaatacaagaatcacttaaaaatttagcggagcaagtaagtgctgcaacgcaaata
acagaaaaatcttcagaaaaactattaaaaatagttaataaaaaaattattgatgccgaa
caatctatttataagctgtataatcaattaaataccttaaaggtatctcattag

DBGET integrated database retrieval system