KEGG   Rickettsia conorii: RC1134Help
Entry
RC1134            CDS       T00061                                 

Definition
(GenBank) acetyl-CoA acetyltransferase-like protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rco  Rickettsia conorii
Pathway
rco00071  Fatty acid degradation
rco00072  Synthesis and degradation of ketone bodies
rco00280  Valine, leucine and isoleucine degradation
rco00310  Lysine degradation
rco00362  Benzoate degradation
rco00380  Tryptophan metabolism
rco00620  Pyruvate metabolism
rco00630  Glyoxylate and dicarboxylate metabolism
rco00640  Propanoate metabolism
rco00650  Butanoate metabolism
rco00900  Terpenoid backbone biosynthesis
rco01100  Metabolic pathways
rco01110  Biosynthesis of secondary metabolites
rco01120  Microbial metabolism in diverse environments
rco01130  Biosynthesis of antibiotics
rco01200  Carbon metabolism
rco01212  Fatty acid metabolism
rco02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RC1134
   00630 Glyoxylate and dicarboxylate metabolism
    RC1134
   00640 Propanoate metabolism
    RC1134
   00650 Butanoate metabolism
    RC1134
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RC1134
   00072 Synthesis and degradation of ketone bodies
    RC1134
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RC1134
   00310 Lysine degradation
    RC1134
   00380 Tryptophan metabolism
    RC1134
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RC1134
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RC1134
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RC1134
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rco04147]
    RC1134
Enzymes [BR:rco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RC1134
Exosome [BR:rco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RC1134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C Thiolase_N ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AAL03672
UniProt: Q92GI9
Position
complement(1048361..1049125)
Genome map
AA seq 254 aa AA seqDB search
MVDLMQYDGLTDVFSGVFMGITAENISKQFNISRQQQDEFALSSHKKAAKAQLAGVFKDE
ILPVEVTIKKTTSLFDHDETVRPDISLEILSKLRPAFDKNGVVTAGNASSINDGAACLMV
VSEEALKKHNLTPLARIVSYASAGVDPSIMGTAPVPASKKALSKAGWSVNDLEVIEVNEA
FAAQSIYVNREMKWDMEKVNVNGGAIAIGHPIGASGGRVLITLIHGLRRAKAKKGLVTLC
IGGGMGMAMCVEAV
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggttgatctaatgcagtatgacggattaaccgatgtattttcaggagtatttatgggt
attacagccgaaaatatctcgaaacagtttaatattagcagacaacagcaggacgagttt
gccttaagctctcacaagaaagcagctaaagcacagctagcaggagtttttaaagatgaa
atcttacctgtcgaagtaacgattaaaaaaactactagtttgtttgatcatgatgaaaca
gtaagacctgatatcagccttgaaattctgagtaaattacgtcctgcttttgataaaaac
ggtgtagttacagcgggtaatgcttcctctattaatgacggtgcggcatgtcttatggta
gtttccgaagaagctttgaaaaagcataatttaacgccgctagctcgtattgtttcttat
gcttcagccggtgttgatccaagtattatgggtactgcccctgttcctgcatccaaaaaa
gctttaagtaaagcaggttggagcgttaatgatttggaagttatcgaggttaatgaggcg
tttgccgctcaaagtatttatgtaaaccgtgaaatgaaatgggatatggagaaggttaat
gttaacggtggagcaatagccatcggtcatccgatcggggcaagcggcggacgtgtactt
attactctgatacacggcttacgcagagctaaagctaaaaaaggcttagttactttatgt
atcggtggcggtatgggtatggctatgtgcgttgaagcggtttaa

DBGET integrated database retrieval system