KEGG   Rhodobacter capsulatus: RCAP_rcc00518Help
Entry
RCAP_rcc00518     CDS       T01213                                 

Gene name
fadA
Definition
(GenBank) fatty acid oxidation complex, beta subunit
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00071  Fatty acid degradation
rcp00072  Synthesis and degradation of ketone bodies
rcp00280  Valine, leucine and isoleucine degradation
rcp00310  Lysine degradation
rcp00362  Benzoate degradation
rcp00380  Tryptophan metabolism
rcp00620  Pyruvate metabolism
rcp00630  Glyoxylate and dicarboxylate metabolism
rcp00640  Propanoate metabolism
rcp00650  Butanoate metabolism
rcp00900  Terpenoid backbone biosynthesis
rcp01100  Metabolic pathways
rcp01110  Biosynthesis of secondary metabolites
rcp01120  Microbial metabolism in diverse environments
rcp01130  Biosynthesis of antibiotics
rcp01200  Carbon metabolism
rcp01212  Fatty acid metabolism
rcp02020  Two-component system
Module
rcp_M00373  Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:rcp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RCAP_rcc00518 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    RCAP_rcc00518 (fadA)
   00640 Propanoate metabolism
    RCAP_rcc00518 (fadA)
   00650 Butanoate metabolism
    RCAP_rcc00518 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RCAP_rcc00518 (fadA)
   00072 Synthesis and degradation of ketone bodies
    RCAP_rcc00518 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RCAP_rcc00518 (fadA)
   00310 Lysine degradation
    RCAP_rcc00518 (fadA)
   00380 Tryptophan metabolism
    RCAP_rcc00518 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RCAP_rcc00518 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RCAP_rcc00518 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RCAP_rcc00518 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rcp04147]
    RCAP_rcc00518 (fadA)
Enzymes [BR:rcp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RCAP_rcc00518 (fadA)
Exosome [BR:rcp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RCAP_rcc00518 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADE84283
UniProt: D5AMZ4
Position
552951..554162
Genome map
AA seq 403 aa AA seqDB search
MTEAYIYDACRTPRGKGRADGSLHEVTSVALSARLLDAVAERNGLTGPAVEDVIWGNVTQ
VGEQGGCLARSAVLLSGLDESIPGLSINRFCASGMEAVNLAANQVKAGAGAAYIAGGVEM
MSRVAMGSDGAAIAVDPSLAMKTYFVPQGISADIIATEYGFTREMADALAVESQRRAAEA
WAEGRFAKSIVPVKDQNGLTILDRDEYLRPGTTLEDLAKLKPAFKDMGEVMPGFDKVAML
KYPHLERIEHIHHAGNSSGIVDGAAAVLIGSKEFGEAHGLKPRARIRATAKIGTDPTIML
TGPVPVTEKILRDSGMSIADIDLFEVNEAFAAVVLRFMQAFDVGQDRVNVNGGAMALGHP
LGATGAIIIGTLLDELERRDLSTGLATLCIASGMGAATIIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagcctatatctatgacgcctgccgcacgccgcggggcaaggggcgcgctgac
ggcagcctgcatgaagtgacctctgtcgcgctgtcggcgcggcttctggatgcggtggcg
gaacgcaatggcctgacgggtcctgcggtcgaggatgtgatctggggcaatgtcacccag
gtgggcgagcagggcggctgtctggcccggtctgcggtgctgctttcggggctcgatgaa
tcgatccccggtctttcgatcaaccgcttttgcgccagcggcatggaggcggtgaacctg
gccgccaatcaggtcaaggcgggggcgggcgcggcctatatcgcgggcggggtcgagatg
atgagccgcgttgccatgggctcggacggggcggcgatcgccgtcgatccgtcgcttgcg
atgaagacctatttcgtgccgcaggggatttccgccgatatcatcgccaccgaatacggg
tttacccgcgagatggccgatgcgctggcggtcgaaagccagcgccgcgccgccgaggcc
tgggccgaggggcgtttcgcgaaatccatcgtgccggtgaaggatcagaacgggctgacg
attctggaccgcgacgaatatctgcgccccggcacgacgctggaggatctggccaagctc
aagcccgccttcaaggacatgggcgaggtgatgccgggcttcgacaaggtggcgatgctg
aaatatccgcatctggagcgcatcgagcatatccaccatgcggggaactcttcgggcatc
gtcgatggggcggcggcggtgctgatcggctcgaaggagttcggcgaggcgcatgggttg
aagccgcgcgcccgcatccgcgccaccgcgaagatcggcaccgatccgacgatcatgctg
accggcccggtgcccgtcaccgaaaagatcctgcgcgacagcggcatgagcattgccgac
atcgaccttttcgaagtgaacgaggcctttgccgcagttgttctgcgcttcatgcaggcc
tttgacgtcggtcaggaccgggtcaacgtgaacggcggcgcgatggcgctgggtcatccc
ttgggcgcgacgggggcgatcatcatcggcacgctgctggacgagctggaacgccgcgat
ctgtccaccgggcttgcgacgctctgcatcgcttccggcatgggcgcggccacgatcatc
gagagggtctga

DBGET integrated database retrieval system