KEGG   Rhodobacter capsulatus: RCAP_rcc00520Help
Entry
RCAP_rcc00520     CDS       T01213                                 

Gene name
fadB
Definition
(GenBank) fatty acid oxidation complex, alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00071  Fatty acid degradation
rcp00280  Valine, leucine and isoleucine degradation
rcp00281  Geraniol degradation
rcp00310  Lysine degradation
rcp00362  Benzoate degradation
rcp00380  Tryptophan metabolism
rcp00410  beta-Alanine metabolism
rcp00640  Propanoate metabolism
rcp00650  Butanoate metabolism
rcp00903  Limonene and pinene degradation
rcp00930  Caprolactam degradation
rcp01040  Biosynthesis of unsaturated fatty acids
rcp01100  Metabolic pathways
rcp01110  Biosynthesis of secondary metabolites
rcp01120  Microbial metabolism in diverse environments
rcp01130  Biosynthesis of antibiotics
rcp01200  Carbon metabolism
rcp01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RCAP_rcc00520 (fadB)
   00650 Butanoate metabolism
    RCAP_rcc00520 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    RCAP_rcc00520 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    RCAP_rcc00520 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RCAP_rcc00520 (fadB)
   00310 Lysine degradation
    RCAP_rcc00520 (fadB)
   00380 Tryptophan metabolism
    RCAP_rcc00520 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RCAP_rcc00520 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RCAP_rcc00520 (fadB)
   00281 Geraniol degradation
    RCAP_rcc00520 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RCAP_rcc00520 (fadB)
   00930 Caprolactam degradation
    RCAP_rcc00520 (fadB)
Enzymes [BR:rcp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     RCAP_rcc00520 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RCAP_rcc00520 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     RCAP_rcc00520 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 UDPG_MGDP_dh_N NAD_binding_2 DAO Pyr_redox_2 2-Hacid_dh_C NAD_binding_8 F420_oxidored NAD_Gly3P_dh_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ADE84285
UniProt: D5AMZ6
Position
554656..556842
Genome map
AA seq 728 aa AA seqDB search
MTDFTCDLGADGVAVITWDVPGKSMNVMSLEGFAQLSALVDGCLADPACKGIVLTSGKKD
FAGGMDLNVIAKMREGGAEAIFAGVMQMHAVLRKIERAGMDPKTLKGGKPIACVLPGTAL
GIGLELPLSCHRIFAAENPKAKIGLPEIMVGIFPGAGGTTRLVRKMGAMMAAPFLLEGKL
SDPKAAKAAGIIDEVSADPMAAARDWVLNATEADLVKPWDAKGYKMPGGAPYHPAGFMTY
VGASAMVSAKTMGVYPAAKALLSAVYEGALVPFDQALRIEARWFTKVLMNPSSTAMIRSL
FINKEALEKGANRPKVADQSVKKLGVLGAGMMGAGIAYVSANAGIEVVLIDASQEAAERG
KAYATGILDKGIQRRKVTEAKKAEVLGRITATTDYAALAGCDLVVEAVFEDPAVKAEVTA
KAEAVIPETAIFATNTSTLPISGLAKASQRPAHFIGIHFFSPVDKMNLVEIIKGKDTGEV
AVAKALDFVRAIRKTPIVVNDARFFYANRCIIPYINEGIRMVAEGVNPVLIENAAKLVGM
PLGPLQLVDETSIDLGVKIAKATKAAMGEAYPDGAVDAVVFWMAEQGRLGKKADAGFYTY
DAGKRGGMWEGLAAQYPRAAAQPELSHVQHRLLMVQVLEAVRAFEQGVLTDIREGDVGAI
LGWGFAPWSGGPFAWLDILGAARAVEICDALSARYGARFETPALLRDIAAKGDSFHARFG
GGAAAKAA
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttcacctgtgatctgggcgccgatggcgtggccgtcatcacctgggacgtg
cccggcaagtcgatgaacgtgatgagccttgagggctttgcccagctcagcgcgcttgtc
gacggctgtctggccgatcccgcctgcaagggcatcgtgctgaccagcggcaagaaggat
ttcgccggtggcatggatctgaacgtcattgccaagatgcgcgaaggcggggcggaggcg
atctttgcaggcgtgatgcagatgcatgccgtgctgcgcaagatcgaacgcgccgggatg
gacccgaagacgctgaaagggggcaagccgatcgcctgcgtcctgccgggcacggcgctg
ggcatcgggcttgagctgccgctgtcgtgccaccgcatctttgccgccgagaatccgaag
gcgaagatcggcctgccggaaatcatggtcggcatcttccccggcgcgggcggcacgacg
cggctggtgcggaagatgggcgcgatgatggcggcgccgttcctcttggaaggcaagctc
tccgacccgaaagccgcgaaagcggcggggatcatcgacgaggtctccgccgatccgatg
gccgccgcgcgggactgggtcttgaacgcgaccgaggccgatctggtcaagccctgggat
gccaagggctacaagatgcccggcggcgccccctatcaccccgcgggtttcatgacctat
gtcggcgcttccgccatggtgtcggcgaagacgatgggggtctatccggccgccaaggcg
ctgctgagcgcggtctatgaaggggcgctcgtgccctttgatcaggcgctgcggatcgag
gcgcgctggttcaccaaggtgctgatgaacccgtcctcgacggcgatgatccggtcgctt
ttcatcaacaaggaagcgctggaaaaaggcgcgaaccggcccaaggtcgccgatcagtcg
gtgaagaagctgggcgttctgggcgcgggcatgatgggggcgggcatcgcctatgtgtcg
gccaatgcgggcatcgaagtggtgctgatcgacgccagccaggaggcggccgagcggggc
aaggcctatgcgaccggcatcctcgacaagggcatccaaaggcgcaaggtgaccgaggcg
aaaaaggccgaggttctgggccgcatcaccgccaccaccgattacgcggcgctcgcgggc
tgcgatctggtcgtggaagccgtcttcgaagacccggccgtcaaggccgaggtgacggcg
aaggccgaggcggtgatccccgagaccgcgatctttgccaccaacacctcgaccctgccg
atttcgggtctggccaaggccagccaacgcccggcgcatttcatcggcatccatttcttc
agcccggtcgacaagatgaaccttgtcgagatcatcaagggcaaggacaccggcgaggtc
gccgtggcaaaggcgctcgatttcgtccgcgccatccgcaagacgcccatcgtcgtcaat
gacgcccgcttcttctacgccaaccgctgcatcatcccctatatcaacgagggcatccgc
atggtggccgagggggtgaacccggtcctgatcgagaatgcggcgaagctggtcggcatg
ccgctcggtccgctgcagctggtcgatgaaacctcgatcgatctcggcgtgaagatcgcc
aaggcgaccaaggccgcgatgggcgaggcctatcccgacggcgcggtcgatgcggtggtg
ttctggatggcggaacaggggcggcttggcaaaaaggccgatgcgggcttctacacctac
gacgcgggcaagcgcggcggcatgtgggaggggcttgcggcgcagtatcctcgcgcggcg
gcgcaacccgagctgagccatgtgcagcatcggctgctgatggtgcaggtgctggaggcc
gtgcgcgcctttgaacagggcgtcctgaccgatatccgcgaaggcgatgtcggcgcgatc
ctgggctggggctttgcgccctggtcgggcggccccttcgcctggctcgacattctgggc
gcggcccgggcggtcgagatctgcgacgcgctctcggcccgatacggcgcccgcttcgag
accccggcgctcttgcgcgacatcgccgccaagggcgacagtttccacgcccgtttcggc
ggcggcgcggcggcgaaagcggcctga

DBGET integrated database retrieval system