KEGG   Rhodobacter capsulatus: RCAP_rcc00560Help
Entry
RCAP_rcc00560     CDS       T01213                                 

Gene name
mopB
Definition
(GenBank) molybdenum transport operon repressor MopB
  KO
K02019  molybdate transport system regulatory protein
Organism
rcp  Rhodobacter capsulatus
Brite
KEGG Orthology (KO) [BR:rcp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rcp03000]
    RCAP_rcc00560 (mopB)
Transcription factors [BR:rcp03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    RCAP_rcc00560 (mopB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TOBE HTH_1 TOBE_2 HTH_8 HTH_Tnp_ISL3
Motif
Other DBs
NCBI-ProteinID: ADE84325
UniProt: D5ANH1
Position
complement(599385..600170)
Genome map
AA seq 261 aa AA seqDB search
MTDGVRGALVLERTGARMGAERVALLAAIGRTGSISAAAREVGLSYKAAWDGVQAMNNLL
AAPVVTAAPGGKAGGGAVLTPAGEKLIAAYGAIEAGVAKLLSSFEKSLNLDPAEVLRGLS
LRTSARNAWACKVWSVAADDVAAQVRMRLGEGQDLTAVITARSAAEMRLAPGSEVLALVK
SNFVLLAGAGVPERLSVRNRLRGRVIERIDAPLSSEVTLDLGGGKTITATITRDSAEMLD
LHPGVETTALIKSSHVILALP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgacggacggtgtgcgcggggcgctggtgctggaacggacgggcgcgcggatgggggcg
gagcgggtggcgctgctggcggcgatcgggcgcacgggctcgatatcggcggcggcgcgc
gaggtcgggctgtcctacaaggcggcctgggacggggtgcaggcgatgaacaacctgctg
gcggcgccggtcgtcacggcggcgccgggcggcaaggcggggggcggcgcggtgctgacc
cctgccggcgaaaagctgatcgccgcctatggcgcgatcgaggcgggcgtggccaagctt
ttgagcagcttcgagaaaagcctgaaccttgatccggccgaggtgctgcggggtctgtcc
ttgcggacctcggcgcgcaatgcctgggcctgcaaggtctggtcggtggcggccgatgac
gtggcggcgcaggtgcggatgcggctgggcgaggggcaggatctgacggcggtgatcacc
gcgcgctcggcggccgagatgcggctggcgccgggatccgaggtgctggcgctggtgaag
tcgaacttcgtcctgctggcgggggcgggcgtgccggaacggctttcggtgcgcaaccgg
ctgcgcggccgggtgatcgagcggatcgacgcccccctctcaagcgaggtgacgctggat
ctgggcggcggcaagacgatcaccgccacgatcacccgcgacagcgccgagatgctggat
ctgcatcccggcgtggagacgactgccctgatcaagtcgagccatgtgatcctggccctg
ccctga

DBGET integrated database retrieval system