KEGG   Rhodobacter capsulatus: RCAP_rcc00561Help
Entry
RCAP_rcc00561     CDS       T01213                                 

Gene name
mopA
Definition
(GenBank) molybdenum transport operon repressor MopA
  KO
K02019  molybdate transport system regulatory protein
Organism
rcp  Rhodobacter capsulatus
Brite
KEGG Orthology (KO) [BR:rcp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rcp03000]
    RCAP_rcc00561 (mopA)
Transcription factors [BR:rcp03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    RCAP_rcc00561 (mopA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TOBE HTH_1 TOBE_3 HTH_Tnp_ISL3 HTH_28 HTH_8 HTH_29
Motif
Other DBs
NCBI-ProteinID: ADE84326
UniProt: D5ANH2
Position
600457..601254
Genome map
AA seq 265 aa AA seqDB search
MNEQPLIAALSLQRAGAPRVGGDRIRLLEAIARHGTIAGAAREVGLSYKTAWDAVGTLNN
LFEQPLVEAAPGGRTGGNARVTEAGQALIAGFGLLEGALTKALGVLEGGVSAPEKALNTL
WSLTMRTSNRNTLRCTVTRVTLGAVNAEVELALTDGHSLTAVITERSATEMGLAPGVEVF
ALIKASFVMLAAGGDPGRISACNRLTGIVAARTDGPVNTEIILDLGNCKSITAVITHTSA
DALGLAPGVPATALFKASHVILAMP
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacagcccctcatcgccgccctgagcctgcaacgcgcgggggcgccgcgggtg
ggcggcgaccggatccggctgctggaagcgatcgcccgtcacggcaccatcgccggtgcc
gcgcgcgaagtgggcctgtcctacaagaccgcctgggatgcggtcggcacgctgaacaac
ctgttcgaacagccgctggtcgaggccgcgcccgggggccgcaccggcggcaatgcccgc
gtgaccgaggcggggcaggcgctgattgccgggttcggtctgctggaaggcgcgctgacc
aaggcgctgggcgtgctcgaaggcggcgtcagcgcgccggaaaaagccctcaacaccttg
tggagtctgacgatgcgcacttcgaaccgcaacaccctgcgctgcaccgtcacccgcgtc
acccttggcgcggtcaatgccgaggtggaactggcgctgaccgatggccacagcctgacc
gcggtgatcaccgaacgctcggccaccgaaatgggcctggccccgggggtcgaggtcttc
gcgctgatcaaggccagtttcgtgatgctggccgcgggcggcgatccgggccggatttcc
gcctgcaaccggctgaccggcatcgtcgccgcccgcaccgacggcccggtgaacaccgag
atcatcctggatctgggcaattgcaaatcgatcaccgccgtcatcacccataccagcgcc
gatgcgctgggcctcgcccccggcgtgcccgccaccgcgctgttcaaggccagccatgtc
atcctggcgatgccctga

DBGET integrated database retrieval system