KEGG   Rhodobacter capsulatus: RCAP_rcc00562Help
Entry
RCAP_rcc00562     CDS       T01213                                 

Gene name
modA1
Definition
(GenBank) molybdenum ABC transporter, periplasmic molybdenum-binding protein ModA-1
  KO
K02020  molybdate transport system substrate-binding protein
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp02010  ABC transporters
Module
rcp_M00189  Molybdate transport system
Brite
KEGG Orthology (KO) [BR:rcp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RCAP_rcc00562 (modA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rcp02000]
    RCAP_rcc00562 (modA1)
Transporters [BR:rcp02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Molybdate transporter [MD:M00189] [OT]
    RCAP_rcc00562 (modA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_11 SBP_bac_1 PE
Motif
Other DBs
NCBI-ProteinID: ADE84327
UniProt: D5ANH3
Position
601289..602047
Genome map
AA seq 252 aa AA seqDB search
MTQFPQTLRAGATALALVMGLALPAAAGEVIAAVAANFTEPAKEIGALFTEKTGHTVTYA
FGPSGQFYTQITQGAPFEVFLSADASRPKKAVEEGYAVPGSDFTYAVGKLVLWSADPARV
DDKGAVLKTDLEHVAIADPKSAPYGAAAIEVMQKLGVYETLEPKLVTGKSISQAYEFAAT
GNAPVGFVAYSQVIGKEGGSSWMVPQDLYKPIKQDAVLLKTGAEDAAAKAYLDFLKTPEA
LEIIRKYGYVTE
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgacccagttcccgcagaccctgcgcgcaggtgcgaccgcgcttgccctcgtgatgggg
cttgccctgcccgccgccgcgggcgaggtgatcgccgccgtcgccgcgaacttcaccgaa
ccggccaaggaaatcggcgcccttttcaccgaaaagaccggccataccgtcacctatgcc
tttggcccctcggggcagttctacacccagatcacccagggggcgccgttcgaggtcttt
ctttcggccgatgcgtcgcgcccgaaaaaggcggtcgaagagggatacgccgtcccgggc
agcgatttcacctatgcggtgggcaagctggtgctgtggtcggccgatccggcccgggtc
gatgacaagggcgcggtgctgaaaaccgatctcgaacatgtggcgatcgccgatccgaaa
tccgccccctatggcgccgccgcgatcgaggtgatgcagaagcttggcgtctacgagacg
ctggaaccgaagctggtcaccggcaaaagcatcagccaggcttacgaattcgccgcgacg
ggcaatgcgccggtgggtttcgtcgcctattcgcaggtgatcggcaaggagggcgggtcc
agctggatggtgccgcaagatctctacaaaccgatcaagcaagacgcggtgctgctgaag
accggcgccgaggatgcggcggcgaaagcctatcttgatttcctgaagacgccggaggcc
ttggaaatcatcaggaaatacggttacgtcaccgaataa

DBGET integrated database retrieval system