KEGG   Rhodobacter capsulatus: RCAP_rcc00568Help
Entry
RCAP_rcc00568     CDS       T01213                                 

Gene name
rpoN
Definition
(GenBank) RNA polymerase sigma-54 factor
  KO
K03092  RNA polymerase sigma-54 factor
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rcp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RCAP_rcc00568 (rpoN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rcp03021]
    RCAP_rcc00568 (rpoN)
Transcription machinery [BR:rcp03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     RCAP_rcc00568 (rpoN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_DBD Sigma54_CBD Sigma54_AID HTH_3 HTH_Crp_2 HTH_38 HTH_IclR
Motif
Other DBs
NCBI-ProteinID: ADE84333
UniProt: D5ANH9
Position
complement(608378..609664)
Genome map
AA seq 428 aa AA seqDB search
MELAQTLSQRQTMQMAGQMLHSLAILGMSSQDLSEHLTEQATSNPFLTYRAPPAFIARGG
EDFDAVAAVAAHKPSLMAHVVDQIEMAFTETPDRLLALRFAEALEPSGWLGQSLDSIALA
AGVSLSRAESMLAVLQGFEPTGLFARDLSDCLILQAREADILTWEVETLIRNIRLIAENR
LSDLADLCDCDIGDIPEIIKQIRHLNPKPGLAFDHQPTPVFPPDLIAVRGAEGWTVELNR
ATSPTITVREDRFADGTADAKARAERRKALAEARALAQALERRGDTLLRTAAVLVARQSA
FLDKGPAHLVPLTLEDVASELGLHASTISRAVSGRMIQTQTRALPLRAFFSRAVSTQGGG
EAVSRDSALDFVQRTVGGEDPQNPLSDDAIVTLAERAGLRIARRTVAKYRSTLGLASSYE
RRRAAAAR
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggaactcgcgcagacgctttcccaaagacagacgatgcagatggcggggcagatgctc
cattccctcgccatccttggcatgtcgtcgcaggatttgtccgagcatctgaccgaacag
gccacatcgaacccctttctgacctaccgcgccccgcccgccttcatcgcccgcggcggc
gaggatttcgacgccgtggccgcggtggccgcgcacaagcccagcctgatggcccatgtg
gtcgatcagatcgagatggccttcaccgagacccccgaccggctgctggcgctgcgcttt
gccgaggcgctggagccgagcggctggctgggccagagcctcgacagcatcgcgctggcg
gcgggcgtgtcgctttcgcgcgccgaatcgatgctggcggtcctgcagggcttcgagcct
accggccttttcgcccgcgacctgtcggattgcctgatcctgcaggcgcgcgaggccgac
atcctgacctgggaagtcgaaacgctgatccgcaacattcggctgatcgcggaaaaccgg
ctgtccgatctggccgatctttgcgattgcgacatcggcgacatccccgaaatcatcaag
cagatccggcacttgaacccgaagccggggcttgctttcgaccatcagccgacgcccgtt
ttcccgcccgatctgatcgccgtgcgcggcgccgagggctggacggtggaactcaaccgc
gccacctcgcccacgatcaccgtgcgcgaagatcgtttcgccgatggcaccgccgatgcg
aaggcgcgcgcggaacggcgcaaggcgctggccgaggcccgggcgctggcgcaggcgctg
gagcgacgcggcgatacgctgttgcgcaccgccgccgtgctggtggcgcggcaatcggcc
ttcctcgacaaggggcccgcccatctggtgccgctgacgctggaggatgtggcctcggaa
ctgggcctgcatgcctcgacgatttcgcgcgcggtctcggggcggatgatccagacccag
acccgggcgctgccgctgcgggcgttcttttcccgcgcggtctcgacccagggcggtggc
gaggcggtgtcgcgcgacagcgcccttgatttcgtgcagcgcaccgtgggcggcgaagat
ccgcaaaacccgctgtcggatgatgcgatcgtgacgctcgccgaacgcgccgggctgcgg
atcgcgcggcggacggtggcgaaataccgctcgacgctgggccttgcctcctcctacgag
cgtcgccgcgccgccgccgcgcgctga

DBGET integrated database retrieval system