KEGG   Rhodobacter capsulatus: RCAP_rcc00569Help
Entry
RCAP_rcc00569     CDS       T01213                                 

Gene name
nifU1
Definition
(GenBank) nitrogen fixation protein NifU-1
Organism
rcp  Rhodobacter capsulatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NifU
Motif
Other DBs
NCBI-ProteinID: ADE84334
UniProt: D5ANI0
Position
complement(609803..610231)
Genome map
AA seq 142 aa AA seqDB search
MKDLFDESLTLDTALPRPQAPPAAAALAARQAAGGKAPDTAAFLANFVRIGEIAAPKPPA
APLFPPEEEAAVVAELIAEMRPMFQRDGGDIELIGLTGATVQVRLSGSCAGCMMSARTLS
TVQHQLIETLGRPVRVVPEIRH
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatctcttcgacgaaagcctgacgctggacaccgcgctgccgcggccccaggca
ccgcccgccgccgcggccctggccgcccggcaggccgcgggcggcaaggcccccgacacc
gccgccttccttgcgaatttcgtcaggatcggagagatcgccgccccgaaacccccggcc
gcgccgctgtttccgcccgaggaagaagccgcggtcgtcgccgagctgatcgccgagatg
cgcccgatgttccagcgcgacggcggcgacatcgagctgatcggcctcaccggcgccacc
gttcaggtgcggctttcgggcagctgcgcgggctgcatgatgtcggcgcgcacgctttcc
acggtgcaacaccagctgatcgaaaccctgggccgcccggtccgggtcgtccccgagatc
cggcactga

DBGET integrated database retrieval system