KEGG   Rhodobacter capsulatus: RCAP_rcc00570Help
Entry
RCAP_rcc00570     CDS       T01213                                 

Gene name
nifK
Definition
(GenBank) nitrogenase molybdenum-iron protein beta chain
  KO
K02591  nitrogenase molybdenum-iron protein beta chain [EC:1.18.6.1]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00625  Chloroalkane and chloroalkene degradation
rcp00910  Nitrogen metabolism
rcp01100  Metabolic pathways
rcp01120  Microbial metabolism in diverse environments
Module
rcp_M00175  Nitrogen fixation, nitrogen => ammonia
Brite
KEGG Orthology (KO) [BR:rcp00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    RCAP_rcc00570 (nifK)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RCAP_rcc00570 (nifK)
Enzymes [BR:rcp01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.6  With dinitrogen as acceptor
    1.18.6.1  nitrogenase
     RCAP_rcc00570 (nifK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro DUF3364
Motif
Other DBs
NCBI-ProteinID: ADE84335
UniProt: D5ANI1
Position
complement(610460..611998)
Genome map
AA seq 512 aa AA seqDB search
MPQSADKVLDHSKLFFEPEYKEMLANKKATFECGHSAETLAQIGDWTASWEYREKNLARE
ALTINPAKACQPVGAVFAAQGYEGTLPFVHGSQGCVAYYRSHLSRHFKEPSAAVSSSMTE
DAAVFGGLTNMVEGLANAYALYKPKMIAVSTTCMAEVIGDDLSSFIIKAKEAESVPVDFP
VPFAHTPAFVGSHVDGYDNTQKGILSLFWAGAERVANDSLNIIPGFDGYAVANNREIKRL
LDTMGVSFTFLSDVSEVYDTPSDGHYRMYAGGTKLEDAKAAVNAKATLSMQEWCTPKTLE
YVETTGQETAVFNYPMGVSATDSFLMKVSELTGKAIPDSIKLERGRLVDAIADSQAYLHG
KTFSIFGDPDFVLGMAKFIMEMGGEPVHCLATNGSKKWAKQMEEVLAASPFGKQGQVWAG
KDLWHMRSFLMTEPTDFLIGSSYGKYLERDTGIPLIRLTFPIFDRHHHHRFPTWGYQGGL
TVLVKILDAIFVKADARAGDWGKTDISFDLTR
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgccccagtcggctgacaaggtgctcgaccactcgaaactgttcttcgagcctgaatac
aaagagatgctcgccaacaagaaggcgaccttcgaatgcggccattccgccgaaaccctc
gcccagatcggcgactggacggcgtcctgggaataccgcgaaaagaacctcgcccgcgaa
gccctgaccatcaacccggcgaaagcctgccagccggtcggcgccgtctttgccgcgcag
ggctatgaaggcaccctgcccttcgtgcatggctcgcaaggctgcgtggcctattaccgg
tcgcacctgtcgcgtcacttcaaggaaccttcggcggcggtgtcgtcctcgatgaccgaa
gatgccgcggtgttcggcggtctgaccaacatggtcgagggcctggccaacgcctatgcg
ctttacaagccgaagatgatcgccgtttcgaccacctgcatggccgaagtcatcggcgac
gacctcagctcgttcatcatcaaggcgaaagaggccgaaagcgtgccggtcgatttcccg
gtgcccttcgcccacaccccggcctttgtcggctcgcatgtggacggctatgacaacacc
cagaaaggcatcctgtcgctgttctgggccggggccgagcgcgtggcgaatgacagcctg
aacatcatcccgggcttcgacggttacgccgtggcgaacaaccgcgaaatcaagcgcctg
ctggatacgatgggcgtcagcttcaccttcctgtcggatgtgtcggaagtctatgacacc
ccctcggacgggcattaccgcatgtatgcgggcggcacgaaactcgaagacgcgaaagcc
gcggtgaacgccaaggcgacgctctcgatgcaggaatggtgcacgccgaagacgctcgaa
tatgtcgaaacgactggtcaggaaaccgccgtcttcaactatccgatgggcgtttccgcc
accgacagcttcctgatgaaagtctcggaactgaccggcaaggcgatcccggacagcatc
aagctggaacgcggccgtctggtcgacgcgatcgcggacagccaggcctatctgcacggc
aagaccttctcgatcttcggcgacccggacttcgttctgggcatggcgaagttcatcatg
gagatgggcggcgagccggtgcattgcctcgccaccaacggctcgaagaaatgggccaag
cagatggaagaagttctggccgcttcgcccttcggcaagcagggtcaggtctgggcgggc
aaggatctgtggcacatgcgcagcttcctgatgaccgaaccgaccgatttcctgatcggc
tcgtcctacggcaaatatctggaacgcgacaccggcatcccgctgatccgtctgaccttc
ccgatcttcgaccgtcaccaccaccaccgcttcccgacctggggctatcagggcggcctg
acggttctggtcaagatcctcgacgcgatcttcgtcaaagccgacgcccgcgccggtgac
tggggcaagaccgacatcagcttcgatctgacccgctga

DBGET integrated database retrieval system