KEGG   Rhodobacter capsulatus: RCAP_rcc00576Help
Entry
RCAP_rcc00576     CDS       T01213                                 

Gene name
cbbO
Definition
(GenBank) rubisco activation protein CbbO
Organism
rcp  Rhodobacter capsulatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA
Motif
Other DBs
NCBI-ProteinID: ADE84341
UniProt: D5ANI7
Position
complement(616347..618590)
Genome map
AA seq 747 aa AA seqDB search
MSAPLAPEPLPDAAQDALTRLAPEAARALSAQGRAVWHEGAAALSRSGKGAEAVQAWAEA
ALPVARDLGEDVLPDLLRACLAMAARTSGAVIARVLATAPLAARRLGDADLFRAYLGFLD
LLLAQAPRGVRPMLDQLDRLLAVLTLGGLRRWALWGAEMHRTNYPEQARYFALESAEAQA
VLQRERKGVLFVDIHRRIGAYLRALWGRDFPMRPTSGDFETREGLRPCLEAGVIHLPDAW
DDTQGATGLDLYRAAAAHAAAHLAARRGPLLMEGLNLHQRACIGLIEDARAEALAIARFP
GLGPLWARFHTGTGPLDRIARALLLPATPETDPNALWARAALAGADLADEMAALRIGLAL
AARLDPRLPTPALPYRDDNRALWEGDESDWSDGVAPPAQIRRHVSVSELVNEVEVETAGD
DAQEILVCATELFDDAGSSFNAREGRPPVAPPRRYPEYDHRSGFDRPDWVTVHDKRPRPG
DPDLTEAILQAHRPVLARMRRVLEALQPQGVQRVRRLEDGDELDLNAAIGAAVDLRLGRQ
PDPRVMMRQRQVTRDVAVLLLLDLSASTNDPAGPGGRRLLDLTREATVLLAEAVHRVGDP
FALHGFCSDGRHNVFYQRFKDFAEVWGPGPKARLAGMEGQLSTRMGAAIRHAGWHLGQQR
AARKLLLVLTDGAPADIDERAPAHLRHDARAAVAALARQGVLPFCLSLDPEADAYVAQIF
GPRGYQILDRVERLPERLPRLYAGLAR
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccccgcttgcccccgagcccctgcccgatgcggcgcaggacgccctgacgcgc
ctcgcccccgaggcggcgcgggcgctttcggcgcagggccgcgcggtctggcacgagggc
gcggcggcgctttcccgcagcggcaagggcgccgaggcggtgcaggcctgggccgaggcg
gccctgcccgtcgcccgcgatctgggggaagacgttctgccggaccttttgcgcgcctgt
ctggcgatggccgcgcgcacctcgggcgcggtgatcgcgcgggttctggcgacggcgccg
ctcgccgcgcggcggctgggcgatgccgatctgttccgcgcctatctggggtttctggat
ctgctgctggcgcaggcgccgcggggggtgcggccgatgctggatcagctcgacaggctt
ctggccgtgctgacgctgggcggtctgcgccgctgggcgctgtggggcgccgagatgcac
cgcacgaattaccccgaacaggcgcgctattttgcgctcgaaagcgccgaggcgcaggct
gtgcttcaacgcgaacgcaagggcgtgctgttcgtcgatatccaccgccgcatcggcgcc
tatctgcgtgcgctttgggggcgggattttccgatgcgcccgacctcgggcgatttcgag
acgcgcgaggggctgcggccctgtctggaagccggggtgatccatctgcccgatgcctgg
gatgatacgcagggcgcgacggggcttgatctttaccgcgccgccgccgcccatgccgcc
gcccatctggcggcgcggcgggggccgctgttgatggaggggctgaacctgcatcagcgc
gcctgcatcgggctgatcgaggatgcaagggccgaggcgctggcgattgcccgctttccg
gggcttggcccgctttgggcgcggtttcataccggcaccgggccgctcgaccgcatcgcc
cgcgcgctgcttttgcccgcgacgccggaaaccgacccgaacgcgctttgggcccgggcg
gcgctggccggggccgatcttgccgacgagatggccgcgctgcgcatcggccttgcgctg
gccgcgcggcttgatccgcgcctgcccacgcccgccctgccctatcgcgatgacaaccgc
gcgctgtgggaaggcgacgaaagcgactggtcggacggggtggcaccgcccgcgcagatc
cgccgtcatgtctcggtttccgagctggtgaacgaggtcgaggtcgaaaccgcgggggac
gatgcgcaggaaatcctggtctgcgcgaccgagctgtttgacgatgccggcagcagcttc
aacgcgcgcgaggggcgcccgcccgtcgcgccgccacgccggtatccggaatacgaccac
cgcagcgggttcgaccggcccgactgggtgacggtgcatgacaagcgcccccgccccggt
gatccggacctgaccgaggcgatcttgcaggcgcaccgcccggttctggcgcggatgcgc
cgggtgctggaggcgctgcagccgcagggcgtgcagcgggtgcggcggctggaagacggc
gacgagctggatctgaacgccgcgatcggtgcggcggtcgatctgcggctgggccgtcag
cccgacccgcgggtgatgatgcggcaacgtcaggtcacgcgagatgtggcggtgctgctc
ttgctcgatctgtccgcctcgaccaatgatccggcggggcccgggggcaggcggcttctg
gatctgacccgcgaagcgaccgtgctgctggccgaggcggtgcaccgcgtcggcgatcct
ttcgcgctgcacggcttttgctcggacgggcggcacaatgtgttttatcagcgtttcaag
gactttgccgaggtgtgggggcccggccccaaggcccggctggcggggatggaggggcag
ctttccacccggatgggcgccgcgatccggcatgcgggctggcatctgggccagcagcgc
gcggcgcgcaagctgctgttggtgctgaccgacggggcgcccgccgatatcgacgaacgc
gcccccgcgcatctgcgtcacgacgcccgcgccgcggtggccgcgctggcgcggcagggc
gtgctgcccttctgcctcagccttgatcccgaggcggatgcctatgtggcgcagatcttc
gggccgcgcggctaccagatcctcgaccgcgtcgagcgcctgcccgaacgcctgccccgc
ctttacgccgggctcgcccgctga

DBGET integrated database retrieval system