KEGG   Rhodobacter capsulatus: RCAP_rcc00587Help
Entry
RCAP_rcc00587     CDS       T01213                                 

Gene name
anfG
Definition
(GenBank) nitrogenase iron-iron protein, delta subunit
  KO
K00531  nitrogenase delta subunit [EC:1.18.6.1]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00625  Chloroalkane and chloroalkene degradation
rcp00910  Nitrogen metabolism
rcp01100  Metabolic pathways
rcp01120  Microbial metabolism in diverse environments
Module
rcp_M00175  Nitrogen fixation, nitrogen => ammonia
Brite
KEGG Orthology (KO) [BR:rcp00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    RCAP_rcc00587 (anfG)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    RCAP_rcc00587 (anfG)
Enzymes [BR:rcp01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.6  With dinitrogen as acceptor
    1.18.6.1  nitrogenase
     RCAP_rcc00587 (anfG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AnfG_VnfG
Motif
Other DBs
NCBI-ProteinID: ADE84352
UniProt: D5ANJ8
Position
628548..628895
Genome map
AA seq 115 aa AA seqDB search
MTDISEKLDPLVDYIMKNCLWQFNSRGWDRLKQNAGILSQTCEILCGEEPVHETAMDRCY
WVDAVILSRAYKARFPWLMAMTKPEIKSLFKALHEKIDHLTVHGSLNTELTVPHY
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatatcagcgaaaaactcgatccgctcgtcgattacatcatgaagaactgcctg
tggcagttcaactcgcgcggctgggaccggctcaagcagaatgccgggatcctgtcgcag
acctgcgagatcctgtgcggcgaggagccggtgcatgaaaccgcgatggaccgctgctac
tgggtcgatgcggtgatcctgtcgcgcgcctacaaggcccgcttcccctggctgatggcc
atgaccaagcccgagatcaagagcctgttcaaggcgttgcacgagaagatcgaccatctc
accgttcacggctcgctcaataccgagctgaccgtcccgcattattga

DBGET integrated database retrieval system