KEGG   Rhodobacter capsulatus: RCAP_rcc00593Help
Entry
RCAP_rcc00593     CDS       T01213                                 

Definition
(GenBank) protein of unknown function DUF1285
  KO
K09986  uncharacterized protein
Organism
rcp  Rhodobacter capsulatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1285
Motif
Other DBs
NCBI-ProteinID: ADE84358
UniProt: D5ANK4
Position
complement(633028..633615)
Genome map
AA seq 195 aa AA seqDB search
MTETAAPQIAVKPPSAEGIAAAVTKAGAKGPPPVHLWDPPFCGDLDIEIRRDGTWFYLGT
PIGREALVRLFASVLKLEDGRFYLVTPVEKVGIRVQDAPFLAVDCTAEAGDLRFVTNVGD
EVVAGPDHPIRVEIAADGEPRPYLHVRRGLEARIDRKTFYRLVDLAAPGPHAGEDWLGLT
SGGVFFPIQRMAEIS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagacagccgcgccacaaatcgccgtgaagccgccgagtgccgaggggatcgcc
gcagccgtgacgaaagccggggccaaggggccgccgccggtgcatctgtgggacccgccc
ttttgcggcgatctggacatcgagatccgccgcgacgggacctggttctatctgggcacg
ccgatcggccgcgaggctctggtgcggctcttcgcatcggtgctgaagctggaagacggc
aggttctatctggtgaccccggtcgaaaaggtcggcatccgggtgcaggacgcgcccttc
cttgccgtcgattgcaccgccgaggcgggggatctgcgcttcgtgaccaatgtgggcgac
gaggtggtggcaggcccggaccatccgatccgggtggagatcgcggcggatggcgagcca
cggccctatctgcatgtgcgccggggccttgaggcgcggatcgaccgcaagaccttttac
cggctggtcgatctggccgcgcccggcccgcatgcgggcgaggactggcttgggctgacc
tcgggcggggtgttctttccgatccagcggatggcggagatttcatga

DBGET integrated database retrieval system