KEGG   Rhodobacter capsulatus: RCAP_rcc00594Help
Entry
RCAP_rcc00594     CDS       T01213                                 

Definition
(GenBank) ATPase, MoxR family protein
  KO
K03924  MoxR-like ATPase [EC:3.6.3.-]
Organism
rcp  Rhodobacter capsulatus
Brite
KEGG Orthology (KO) [BR:rcp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RCAP_rcc00594
Enzymes [BR:rcp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     RCAP_rcc00594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_3 AAA_5 AAA RuvB_N Mg_chelatase Sigma54_activat AAA_16 AAA_30 MCM AAA_22 AAA_29 AAA_33
Motif
Other DBs
NCBI-ProteinID: ADE84359
UniProt: D5ANK5
Position
633688..634701
Genome map
AA seq 337 aa AA seqDB search
MTETDTLLAEIEALGSKLGAARASVNRRFIGQERVVELTLAALLSGGHALLVGLPGLGKT
MLVDTLATVMGLAPARIQFTPDLMPADILGSEVLETAADGSRAFRFLEGPIFCQLLMADE
INRASPRTQSALLQAMQEREVTVAGVHRPLGPPFHVLATQNPIEQEGTYPLPEAQLDRFL
VQVDVDYPTRATERDILLATTGVEAARAIAVFTPAELIAAQQLVRRMPVGDRVVEAILDL
VRACRPGEPEALPVIRDSLAWGPGPRAAQALMLTVRARALLNGRLAPGIDDVAALARPVL
SHRMALTFAARARGETLSAIIARAVTEVLGTEAEAAA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaccgatacccttctggccgagatcgaggctctgggcagcaaactgggcgcc
gcccgtgcctcggtgaaccgccgcttcatcgggcaggaacgcgtggtggagctgaccttg
gccgcgcttttgtcgggcgggcatgcgctgctggtcggcctgccggggttgggcaagacg
atgctggtggacacgctggccacggtgatgggccttgcccccgcccgcatccagttcacc
cccgatctgatgcccgccgacattcttggctccgaggtgctggaaaccgccgccgacggc
agccgggcgttccggtttctggaagggccgatcttctgccagcttctgatggccgacgag
atcaaccgcgccagcccccgcacgcaatcggcgctgttgcaggcgatgcaggaacgcgag
gtgacggtggcgggcgtgcatcggccgctcggaccgccctttcatgtgctggcgacgcaa
aacccgatcgagcaggaggggacctatcccctgcccgaggcgcagctggaccgcttcctc
gtgcaggtcgatgtcgactatccgacccgcgccaccgaacgcgacattcttctggccacg
accggggtcgaggccgcccgcgccatcgccgtcttcaccccggcagagctgatcgcggcg
cagcagctggtgcgtcgcatgccggtcggcgatcgtgtggtcgaggcgatcctggatctg
gtccgcgcctgccgccccggcgagcccgaggcgctgcccgtcatccgcgacagcctggcc
tggggccccggtccgcgcgcggcacaggcgctgatgctgacggtgcgggcgcgggcgctg
ctcaatggtcgtctggcgccgggcatcgacgatgtggcggcgctcgcccgtccggtgctc
agccaccgcatggcgctgaccttcgccgcccgcgcgcgcggcgaaaccctgtccgcgatc
atcgcccgcgccgtgaccgaggttctggggaccgaagccgaggccgccgcgtga

DBGET integrated database retrieval system