KEGG   Rhodobacter capsulatus: RCAP_rcc00595Help
Entry
RCAP_rcc00595     CDS       T01213                                 

Definition
(GenBank) protein of unknown function DUF58
Organism
rcp  Rhodobacter capsulatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF58
Motif
Other DBs
NCBI-ProteinID: ADE84360
UniProt: D5ANK6
Position
634698..635606
Genome map
AA seq 302 aa AA seqDB search
MSDPLPDAAARDLRRAAEAEAAALPALLIAAEHLANTVQMGGHGRRRAGAGEEFWQYRPA
HSGDEARFVDWRRSARSDAQFVRDREAQLAQSLCLWVDPAASMRFSGAETGRKARPEKQT
RARLLVLALAISALRAGERVGLASPLAPPRPGRAQLLTLAQALLAESSAQDHVAPDLSAV
APQARLVLLSDFFADPAALEAALAGVAGRGVTGVLLQVLDPAEEDFPYDGRTVFTSMAGG
LRFETREAGDLRARYRARLAERRDRIARIAERAGFAFSSHHTGVPAQAALLWLHGALAGG
WR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacccccttcccgatgcggcggcacgcgatctgcgccgggccgccgaggcggaa
gccgcggccctgcccgcgctgctgatcgccgccgaacatctggccaacaccgtgcagatg
ggcggccatgggcgccgccgcgcgggtgcgggcgaggaattctggcaataccgccccgcc
cattccggcgacgaggcccgttttgtagactggcgccgctcggcccggtctgacgcgcaa
ttcgtccgcgaccgcgaggcgcagctggcgcaatcgctctgcctttgggtcgatccggcg
gcttcgatgcgcttttccggcgccgagaccggccgcaaggcccggcccgagaaacagacc
cgcgcccggcttctggtgctggcgctggcgatttccgcgctgcgggcgggggaacgggtg
gggcttgcaagcccgctggcgccgccgcggccgggcagggcgcagctgctgacgctggca
caggcgcttttggccgaaagctcggcgcaggaccatgtcgcccccgatctgtcggccgtg
gcgccgcaggcgcggctggtgctgctgtcggatttcttcgccgatcccgcggcgcttgaa
gccgcgcttgcgggcgtggccgggcgcggcgtgaccggcgtcctgctgcaagtgctggat
ccggccgaggaagattttccctatgacggccgcaccgtcttcacctcgatggcgggcggg
ctgcggttcgaaacccgcgaggcgggcgatctgcgcgcccgctaccgggcacgtctggcc
gagcggcgcgaccgcatcgcccgcatcgccgagcgcgcgggcttcgccttttccagccac
cacaccggcgtcccggcgcaggcggcgcttttgtggctgcatggcgcgctggcggggggc
tggcgatga

DBGET integrated database retrieval system