KEGG   Rhodobacter capsulatus: RCAP_rcc00604Help
Entry
RCAP_rcc00604     CDS       T01213                                 

Definition
(GenBank) integral membrane protein, TerC family
  KO
K05794  tellurite resistance protein TerC
Organism
rcp  Rhodobacter capsulatus
Brite
KEGG Orthology (KO) [BR:rcp00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    RCAP_rcc00604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TerC
Motif
Other DBs
NCBI-ProteinID: ADE84369
UniProt: D5ANL5
Position
complement(648616..649605)
Genome map
AA seq 329 aa AA seqDB search
MELVFLSFLGQPLWMWLVFVSLVLTLLALDLGVLNKDDHEIGIAESLKLSAMYIALGLGF
AGFVFWQMGATATAQYLTAFVVEKSLSIDNIFVIALIFGFFAVPRQYQRRVLFWGILGVI
VLRGLMIGLGATLVAEYHWLLYVFAAFLIVTGIKMLFSADKEHEITENGLIRFLRRRLRV
TDGPRGHAFFVTEPDTKTGRLVRHATPLFLALVMIELADLVFAVDSVPAVFTITTDPYIV
YTSNIFAILGLRALYFALSAILARFAYLKYALSVLLVFIGSKVFVAAALGWEKFPPAWSL
GITFAILAAGILFSLWKTGTARGPAHPAE
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtggaactcgtctttctgtcttttcttggccagccgctgtggatgtggctggttttcgtc
agtcttgtcctgacccttctcgcgcttgatctgggcgtgctgaacaaggacgatcacgaa
atcggcatcgccgaaagcctgaagctttcggcgatgtatatcgcgcttggcctcggcttt
gcgggcttcgtcttctggcagatgggcgccaccgcgacggcgcaatatctgaccgccttc
gtggtcgagaaatcgctctcgatcgacaacatcttcgtgatcgcgctgatcttcggcttc
ttcgccgtgccgcggcaatatcagcgccgggtgctgttctggggcattctgggcgtgatc
gtgctgcgcgggctgatgatcggccttggcgcgacgctggtcgccgaataccactggctg
ctttacgtcttcgccgccttcctgatcgtgaccggcatcaagatgctgttttcggccgac
aaggagcacgagatcaccgaaaacgggctgatccgcttcctgcgccgccgcctgcgggtg
acggacggtccgcgcggccatgccttcttcgtcaccgagcccgacacgaaaaccggccgt
ctggtgcgccatgcgacgccgctgttcctggcgctggtgatgatcgagctggccgatctc
gtctttgccgtcgactctgtccccgcggtcttcaccatcaccaccgatccctacatcgtc
tacacctcgaacatcttcgcgatcctcggcctgcgggcgctttacttcgcgctttccgcg
atcctcgcccgcttcgcctatctgaaatacgcgctctcggtgcttctggtgttcatcggc
tccaaggtcttcgtggccgcggcgctgggttgggaaaaattccctccggcctggtcgctt
ggcatcaccttcgcgatccttgccgcaggcatccttttctcgctgtggaagacgggcaca
gcgagagggccggctcatccggctgaatga

DBGET integrated database retrieval system