KEGG   Rhodobacter capsulatus: RCAP_rcc00608Help
Entry
RCAP_rcc00608     CDS       T01213                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rcp  Rhodobacter capsulatus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADE84373
UniProt: D5ANL9
Position
652928..653089
Genome map
AA seq 53 aa AA seqDB search
MPLAPQTLHDKTAAAAKLIIETEAVKRADRTAALKAARLARDAAALPDAKPAR
NT seq 162 nt NT seq  +upstreamnt  +downstreamnt
atgccccttgcgccgcagacgctgcatgacaagacggcagccgcggcgaaactgatcatc
gagacggaagccgtgaagcgcgcggatcgcactgccgcgctcaaggcggcccgtcttgcg
cgcgatgcggcggccctgccggacgcgaagcccgcccgatga

DBGET integrated database retrieval system