KEGG   Rhodobacter capsulatus: RCAP_rcc00616Help
Entry
RCAP_rcc00616     CDS       T01213                                 

Gene name
acrB
Definition
(GenBank) acriflavine resistance protein B
  KO
K03296  hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 family
Organism
rcp  Rhodobacter capsulatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACR_tran SecD_SecF Patched
Motif
Other DBs
NCBI-ProteinID: ADE84381
UniProt: D5ANM7
Position
657903..661028
Genome map
AA seq 1041 aa AA seqDB search
MARFFIDRPIFAWVIALVIMGVGALAILRLPVSQYPSIASPAVVIQAAYPGASAETVTDT
VVQVIEKQMTGLDGLRYLKSDTTATGRATITLTFALGTDPDIAQVQVQNKLAQAEASLPE
AVTRQGVTVEKSTTGFLMVAALISPDKSRSSVELSDYMNASMVESFSRLKGVGAVTVFGS
EHAMRIWLDPGKLKAYDMAPAAVIAAVKGQNAQISAGSFGALPAPEGQMLNATITAQSLL
KTPADFERIVLRADTDGGLVLLRDVARVELGAESYDINAFYNGTPSAGMAIQLASGANAL
DTAKLVKDKLAELAPYFPSGMEYVIPYDTTPFVTLSIEEVIKTLFEAIVLVVLVMLVFLH
NLRATLIPTLAVPVVLLGTFGVMAASGFSINTLTMLAMVLAIGLLVDDAIVVVENVERIM
AEEHLSPREATRKSMGEISGALVGIALVLSAVFVPMAFFGGSTGEIYKQFSVTIVSAMAL
SVLVALVFTPALCATILKPHAEAKGGFANWFGGHFETRFGRLTRGYGGITRWVVANPLKG
LVVYACLVAAMGALYLRTPTAFLPDEDQGVLMTLIQTPSGTTAAETKKVVEQVEGYWRAA
EADNVEALFSVVGFSFAGQGQNMAMMFIKLKDWEDRPGPQNGAQAIAGRAFGPLMGGIKE
AIVIPIVPPPVLELGNSNGFTAFLQARSGQSHEDLLNARNQLLGMAGQSPKLMAVRPNGV
EDAAQFRLDIDWAKAGAVGLTAADVGDFLNTIWSSAYVNDFLHEGRVKRVYVQGEPWARS
TPADFALWRVPNANGDFVSLSTFATEKWVYGPQQIVRYDALPAMEIQGSPVPGLSSGAAM
TEMETLAAQLPPGFALQWSGLSLEEKEAGNNAMALYALSLAAVFLCLAALYESWVIPVAV
ILAMPVGIIGALIGAWLGGQANGVYFQVGLLTVVGLTGKNGIMIVEFARDRMRTLGEDAL
TAAVEAARLRFRPILMTSLAFTLGVVPLILSTGAGAGAREAIGYTTLFGTLTGTGLAIFF
VPLFFRLTNAMFTRRKSPAAA
NT seq 3126 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtttcttcattgaccggccgatcttcgcctgggtcatcgcgctggtgatcatg
ggggtgggggcgcttgcgatcctgcgcctgccggtgtcgcaatatccctcgatcgcctcg
cccgcggtcgtcattcaggcggcctatccgggcgcttcggcggaaaccgtcaccgatacc
gtggtgcaggtgatcgaaaagcagatgaccggccttgacgggttgcgctatctgaaatcc
gacaccaccgcgacgggccgggccacgatcacgctcaccttcgcgctcggcaccgatccc
gacatcgcgcaggtgcaggtgcaaaacaagctggcgcaagccgaggcgagcctgcccgaa
gccgtcacccggcagggcgtgacggtcgagaaatcgacgaccggctttttgatggtggcg
gcgctgatttcgcccgacaagtcccggtcttcggtcgagctgtccgattacatgaacgcc
tcgatggtcgagagcttctcgcggctcaagggcgtgggggcggtcaccgtcttcggctcg
gaacatgcgatgcggatctggctcgatccgggcaagctcaaggcctatgacatggcgccc
gccgcggtgatcgccgcggtgaaggggcagaatgcgcagatctcggccgggtcgttcggg
gccttgcccgcgcccgaggggcagatgctgaatgccacgatcaccgcgcaatcgctgctg
aaaacccccgcggatttcgagcgtatcgtgctgcgcgccgataccgatggcgggctggtc
ttgctgcgcgatgtcgcgcgggtggagctgggcgcggaaagctacgacatcaacgccttt
tacaacggcaccccctcggccgggatggcgatccagctggcttcgggggcgaatgcgctc
gacacggcgaagctggtcaaggacaagctggcggaactggcgccctatttcccctcgggg
atggaatacgtcattccctatgacacgacgccctttgtcaccctctcgatcgaggaagtg
atcaagaccctgttcgaggccatcgtgctggtcgtgctggtcatgctcgtcttcctgcac
aatctgcgcgcgacgctgatcccgacgctggcggtgccggtggtgcttttgggcaccttt
ggcgtgatggcggcctctggcttttcgatcaacaccctgaccatgctggccatggttctt
gccatcgggcttttggtcgatgacgccatcgtcgtcgtcgaaaacgtcgagcggatcatg
gccgaggaacacctttccccgcgcgaggcgacgcggaaatcgatgggggaaatctcgggc
gcgctggtggggattgcgctggtgctctcggcggtcttcgtgccgatggccttctttggc
ggctcgaccggcgagatctacaagcaattctcggtcaccatcgtttcggccatggcgctt
tcggttctggttgcgctcgtcttcacgcccgcgctttgcgccacgatcctcaaaccccat
gccgaggccaagggcggttttgcgaactggttcggcggccatttcgagacccgcttcggg
cggctgacgcgcggctatggcggcatcacccgctgggttgtcgccaatccgctcaagggg
ttggtcgtctatgcctgtctggtggcggcgatgggggcgctttatctgcgcacccccacc
gcgttcctgcccgacgaggatcagggcgtgctgatgacgctcattcagaccccctcgggc
accaccgcggcggaaacgaaaaaggtcgtcgaacaggtcgagggctattggcgcgcggcc
gaggcggacaatgtcgaggcgctgttctcagtcgtcggtttctctttcgccggtcagggc
cagaacatggcgatgatgttcatcaagctgaaggactgggaggaccggccggggccgcaa
aacggcgcacaggcgattgcggggcgggccttcgggccgctgatgggcggcatcaaggag
gcgatcgtgatcccgatcgtgccgccgccggtgctggagctgggcaattcgaacggcttc
accgccttcctgcaggcgcgctcgggccagagccacgaagatctgctgaacgcccgcaac
cagcttttgggcatggccgggcaaagcccgaaactgatggccgtgcgcccgaacggggtc
gaggatgcggcgcagttccgtctggatatcgactgggccaaggcgggggccgtggggctg
accgcggcggatgtgggcgatttcctgaacacgatctggtcttcggcctatgtgaacgac
ttcctgcacgaaggccgcgtcaagcgcgtctatgtgcagggcgagccctgggcgcgctcc
accccggccgatttcgcgctctggcgggtgccgaatgcgaatggcgatttcgtctcgctc
tcgacctttgccaccgagaaatgggtctacgggccgcagcagatcgtgcgctatgacgcg
ctgcccgcgatggagatccagggctcgccggtgccgggcctgtcctctggggcggcgatg
acggagatggagacgcttgccgcgcaattgccgcccggtttcgcgctgcaatggtcgggc
ctgtcgctggaggaaaaagaggcgggcaacaatgccatggcgctttatgcgctctcgctc
gccgcggtcttcctgtgtctggcggcgctttacgaaagctgggtcattccggtggcggtc
attctggcgatgccggtgggcatcatcggggcgctgatcggtgcctggctgggcggtcag
gcgaacggggtctatttccaggtcgggctgctgactgttgtcggtctgaccggcaagaac
ggcatcatgatcgtggaatttgcccgcgaccgcatgcggacccttggcgaagacgcgctg
accgccgcggtcgaggccgcccggctgcgcttccgtccgatcctgatgacttcgctcgcc
ttcaccctgggcgtcgtgccgctgatcctgtcgaccggcgcgggcgcgggggcgcgcgag
gcgatcggctacaccacgctcttcggcacgctgacggggacggggctggcgatcttcttc
gtgccgctcttcttccggctgacgaacgcgatgttcacgcggcgcaagagcccggccgcc
gcctga

DBGET integrated database retrieval system