KEGG   Rhodobacter capsulatus: RCAP_rcc00617Help
Entry
RCAP_rcc00617     CDS       T01213                                 

Definition
(GenBank) secretion protein, HlyD family
  KO
K01993  HlyD family secretion protein
Organism
rcp  Rhodobacter capsulatus
Brite
KEGG Orthology (KO) [BR:rcp00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    RCAP_rcc00617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_3 HlyD_D23 Biotin_lipoyl_2 Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: ADE84382
UniProt: D5ANM8
Position
661180..662184
Genome map
AA seq 334 aa AA seqDB search
MSLPAACRLSLALFLALGLPAQAQSPFAGLLARIEGAGDQTGVTASNGRLEAQSVDVAGK
YAGRLTEVTAAEGQMVEAGAVLARLDDRDAQAKLLAAEAAVLQAEAAKAGAEAAVMQAQS
ALDVAVTTRTRVTTLHAEGHAAQAVLDDAVNGATAAAASLASARAQVQNATALIAAAEAS
REQAKIALEDLVIRAPIRGRVLYRLHEPGEVIAAGTPVVTLLDLTDVYMVLYLPASVVGT
LALNDEARLVLDPVPQYVVPARVSFVAPQAQFTPKSVETSTERADLVFRVKLAIPRDLLL
RFADSVKVGVRGIGFVRATPDTPWPADLAVKLPE
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtccttgcccgccgcctgccgcctctctcttgcgctgtttctggcccttggccttccc
gcgcaggcgcaatcgccctttgccgggcttctggcgcggatcgagggggcgggggatcag
accggcgtgaccgcctcgaacgggcggctggaggcgcaaagcgtcgatgtcgccgggaaa
tatgccgggcggctgaccgaggtcacggccgccgaagggcagatggtcgaggcgggggca
gtgctggcgcggcttgacgaccgcgatgcgcaggcgaaattgctggcggccgaggcggcg
gtgctgcaggccgaggcggccaaggcgggcgccgaagcggcggtgatgcaggcgcaaagc
gcgctcgacgtggcggtgacgacccggacccgcgtcaccacgctgcatgccgagggccat
gcggcgcaggcggttttggacgatgcggtgaacggggcaacggcggcggcggcctcgctc
gcctcggcgcgggcgcaggtgcaaaacgccaccgcgctgatcgccgcggccgaggccagc
cgcgaacaggcgaagatcgcgctggaagatctggtgatccgcgcgccgatccgcggccgg
gtgctctaccggctgcacgagccgggcgaggtgatcgcggcgggcacgcccgtggtgacg
ctgctcgatctgaccgatgtttacatggtgctctatctgcccgcgtctgtcgtggggacc
ttggcgctgaatgacgaggcgcggctggttctggacccggtgccgcaatatgtggtgccc
gcgcgggtcagtttcgttgcgccccaagcgcaattcaccccgaaatcggttgaaaccagc
accgagcgcgcggacctcgtgttccgcgtcaagctggcgatcccgcgcgatctgctcttg
cgctttgccgacagcgtcaaggtcggcgtgcgcggcatcggcttcgtgcgcgcgacgccc
gacacgccctggcccgccgatctggcggtgaagctgcccgagtag

DBGET integrated database retrieval system