KEGG   Rhodobacter capsulatus: RCAP_rcc00619Help
Entry
RCAP_rcc00619     CDS       T01213                                 

Definition
(GenBank) ABC transporter, permease protein
  KO
K01992  ABC-2 type transport system permease protein
Organism
rcp  Rhodobacter capsulatus
Module
rcp_M00254  ABC-2 type transport system
Brite
KEGG Orthology (KO) [BR:rcp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rcp02000]
    RCAP_rcc00619
Transporters [BR:rcp02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    RCAP_rcc00619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_3 ABC2_membrane ABC2_membrane_2 ABC2_membrane_4 DUF3533 ABC2_membrane_5
Motif
Other DBs
NCBI-ProteinID: ADE84384
UniProt: D5ANN0
Position
664898..666016
Genome map
AA seq 372 aa AA seqDB search
MRSLRNILWLTGKELRAIRTDRVMLVLIAYVFTLAVWLVSDAASTEVDHLATAIVDEDRS
PLSARLSDAIRPPLFAAPVPMTAGQAAAAQRAGEAILVLTIPPDFERDLHAGRATTLQIL
VDATAVAQAGNGASFLRQTLLQELSAALTPGAASADPVTVVFRNAFNPNLTSSWFSAVMQ
LMNNVTILMLILSGASMIREREHGTIEHVLVMPVRPHEIVAAKILASGAVILLASLFSLV
VVVEGAMGVPVAGSLWLYAGGAAIYVVAVASLGLLLASFTRTMGQFGLLVIPVIVLMILL
SGGMTPLESMPDWLQGTMRTISPATHFVIFAQAVLYRGAGLSLVWPEMAVMAGMAAVAVT
IVLARFRKVLAG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagccttcgcaacatcctttggctgaccggcaaggagctgcgggcgatccgcacc
gaccgggtgatgctggtgctgatcgcctatgtcttcaccctggcggtctggctggtctcc
gacgccgccagtaccgaggtggatcatctggccaccgccatcgtggacgaggaccgcagc
ccgctctccgcccggctgagcgatgcgatccgcccgccgcttttcgccgcgccggtgccg
atgaccgccgggcaggccgccgccgcccaacgcgcgggcgaggcgatcctggtgctgacg
atcccgcccgatttcgagcgcgacctgcatgcgggccgcgcgacgacgctgcagatcctt
gtcgatgcgacggcggtggcgcaggcgggcaatggcgccagtttcctgcgccagaccctg
ttgcaggagctttccgccgcgctgacgcccggggccgccagcgccgatccggtcaccgtc
gtctttcgcaacgccttcaacccgaacctgacctccagctggttcagcgcggtgatgcag
ctgatgaacaatgtcaccatcctgatgctgatcttgtccggggcctcgatgatccgcgag
cgcgaacatggcacgatcgaacatgtgctggtgatgcccgtccgcccgcacgagatcgtc
gcggcgaagatcctcgcctcgggggcggtgatccttctggcctcgctcttcagcctggtc
gtggtggtcgagggggcgatgggcgttccggtggcgggctcgctttggctttatgccggg
ggggcggcgatctatgtggtggcggtggccagcctgggtctgcttctggcgtcgttcacc
cggacgatggggcaattcgggcttctggtcattccggtgatcgtgctgatgatcctcttg
tcgggggggatgacgccgctggaatcgatgcccgactggctgcagggcacgatgcggacg
atttccccggcgacgcatttcgtcatcttcgcccaggcggtgctctatcgcggcgcgggg
ctgtcgctggtctggccggaaatggcggtgatggcgggcatggcggcggtggcggtgacg
atcgttctggcgcggtttcgcaaggtgctggcgggctag

DBGET integrated database retrieval system