KEGG   Rhodobacter capsulatus: RCAP_rcc00623Help
Entry
RCAP_rcc00623     CDS       T01213                                 

Definition
(GenBank) transcriptional regulator, RpiR family
Organism
rcp  Rhodobacter capsulatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_6 SIS K1377
Motif
Other DBs
NCBI-ProteinID: ADE84388
UniProt: D5ANN4
Position
671478..672308
Genome map
AA seq 276 aa AA seqDB search
MRAIAHFMLAQFQDLPFETAATLAAKVQVSEVSIGRFCRAIGYANFKDLKDHLKGDIGDQ
PWLIKDRLEALRRASDQRDERLSQGLKAEIAGLVGVYELARTEAWARVALRFARARRVLV
AGFQTERGLAQYFAAQMQYVRPGVQSVDLSAGNFAEVLAETDAPEDTCLAIFEARRYARQ
ALVLARAAQARGIAVTIFTDRYCSWGADHASEVFSVATEVNQFWDSTAHLALLGNLLIND
IFLALGEGAETRLNEIARLYGAFSGHVGNPLTQVAQ
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgattgcgcatttcatgctggcgcagtttcaggacctgcccttcgagacggcg
gcgacccttgcggccaaggttcaggtcagcgaggtcagcatcggccggttctgccgcgcc
atcggctatgcgaatttcaaggatctgaaggaccatctgaagggcgacatcggcgatcag
ccctggctgatcaaggaccggctggaggcgctgcggcgggcctcggatcagcgcgacgaa
cggctgtcgcaggggctgaaggccgagatcgccgggctggtgggggtttacgaactggcc
cggaccgaggcctgggcgcgggtggccttgcggtttgcccgggcccggcgggtgctggtg
gcgggcttccagaccgagcgcggcctggcgcaatatttcgccgcgcagatgcaatatgtc
cgccccggggtgcagagcgtcgatctttcggcgggcaatttcgccgaggtcctggccgaa
actgacgcgcccgaggacacctgtctggcgattttcgaggcgcgtcgttacgcccggcag
gcgctggttctggcgcgcgcggcgcaggcgcggggcattgcggtgacgatcttcaccgac
cgctattgcagctggggcgccgatcacgcctccgaggttttcagcgtggcgaccgaggtg
aaccagttctgggattcgacggcgcatctggcgcttttgggcaaccttctgatcaacgac
atctttctggcgctgggcgagggcgccgagacccgtctgaacgaaatcgcgcggctttac
ggcgcgttcagcggccatgtcggcaatccgctgacacaggtcgcgcaatga

DBGET integrated database retrieval system