KEGG   Rhodobacter capsulatus: RCAP_rcc00624Help
Entry
RCAP_rcc00624     CDS       T01213                                 

Definition
(GenBank) amino acid ABC transporter, periplasmic amino acid-binding protein
  KO
K02030  polar amino acid transport system substrate-binding protein
Organism
rcp  Rhodobacter capsulatus
Module
rcp_M00236  Putative polar amino acid transport system
Brite
KEGG Orthology (KO) [BR:rcp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rcp02000]
    RCAP_rcc00624
Transporters [BR:rcp02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    RCAP_rcc00624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd
Motif
Other DBs
NCBI-ProteinID: ADE84389
UniProt: D5ANN5
Position
672332..673108
Genome map
AA seq 258 aa AA seqDB search
MTLRSKLLACTLALVAMTGAAQAEKLRLGTEGAYPPFNFVQPDGTIAGFDLDIGLELCKR
IGADCEVVAQDWDGIIPGLIAQKYDFIIASMFITEERKQQVAFTNPYYMAAMTHVVPKES
ELTEFSNETLSGKVVGAQSGTTQADYAVKMYPDADVRLYPTQDEASLDMASGRLDVMVGD
MLPLLDFVEKSEDGKCCKLAGAPITDPAFVGEGVGIAVRQEDNALRERLNKALDEIRADG
TYKKINDKYFSIDIYSMK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgacactgcgttcgaaacttctggcctgcacgctggcccttgtcgcgatgacgggcgcc
gcgcaggccgagaaactgcgtctgggcaccgagggcgcctatccgcccttcaacttcgtg
cagcccgacggcacgatcgcgggcttcgatctcgatatcgggctggagctgtgcaagcgc
atcggcgccgactgcgaggtggtggcgcaggattgggacggcatcatccccggcctgatc
gcgcagaaatacgatttcatcatcgcctcgatgttcatcaccgaggaacgcaagcagcag
gtggccttcaccaacccctattacatggcggcgatgacccatgtcgttccgaaagagtcc
gaactgaccgaattttcgaacgagaccctgtcgggcaaggtcgtcggcgcgcaatcgggc
acgacgcaggcggattatgcggtgaagatgtatcccgatgccgatgtgcggctgtatccg
acccaggacgaggcaagcctcgacatggcctcggggcggcttgacgtgatggtgggcgac
atgctgccgctgcttgatttcgtcgagaaatccgaagacggcaaatgctgcaagctggcc
ggtgcgccgatcaccgatccggcctttgtcggcgagggcgtgggcattgccgtccggcag
gaggacaacgcgctgcgcgagcgtctgaacaaggccctggacgagatccgcgccgatggc
acctacaagaaaatcaacgacaaatacttctcgatcgacatctattcgatgaagtga

DBGET integrated database retrieval system