KEGG   Rhodobacter capsulatus: RCAP_rcc00625Help
Entry
RCAP_rcc00625     CDS       T01213                                 

Definition
(GenBank) amino acid ABC transporter, permease protein
  KO
K02029  polar amino acid transport system permease protein
Organism
rcp  Rhodobacter capsulatus
Module
rcp_M00236  Putative polar amino acid transport system
Brite
KEGG Orthology (KO) [BR:rcp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rcp02000]
    RCAP_rcc00625
Transporters [BR:rcp02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter [MD:M00236]
    RCAP_rcc00625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ADE84390
UniProt: D5ANN6
Position
673133..673843
Genome map
AA seq 236 aa AA seqDB search
MMETLFSYGPQGWGDELLAGLGVTLQLAAATLPLGLLLGFFVAALSLSRRPGLRAMGWGY
TTVMRGMPEILTLFIVYNGLGLGLNRLLDAFAPQFGAVDFPPFAAGVIALALVFAAFAAE
VLRGAFQSVPEGQVLAGLAIGMTGRQVFWRIKLPQLWRFALPGMGNLWLNLLKDTALVSV
IALDDLMRATKVAVGVTKQPFTFYLAACLIYWALCLGSELVLARLEARANRGLRRV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaacgctgttctcatatggcccccaaggctggggcgacgaactcctcgcgggg
ctcggggtgacgctgcaacttgcggcggccacccttcccttggggcttttgctgggcttt
ttcgtggcggcgctctcgctttcgcgccgccccgggctgcgggcgatgggctggggctac
acgacggtgatgcgcgggatgccggaaatcctgacgctgttcatcgtctacaacgggctg
gggctggggctgaaccggcttctggatgcctttgcgccgcagtttggcgcggtcgatttc
ccgcccttcgcggcgggtgtcatcgcgctcgccctcgtctttgccgccttcgccgccgag
gtgctgcgcggcgcctttcaatccgtgcccgaggggcaggtgctggcgggccttgccatc
ggcatgaccgggcggcaggtgttctggcgcatcaagctgccgcaattgtggcgctttgcc
ctgccgggcatgggcaatctctggctcaacctgctgaaagatacggcacttgtctcggtc
atcgcgctcgatgatctgatgcgggcgaccaaggtcgcggtcggcgtgacgaaacagccc
ttcaccttttatctggccgcctgcctgatctattgggcgctttgccttggctcggaattg
gtgctggcgcggcttgaggcgcgggcgaaccgcggcctgcggagggtctga

DBGET integrated database retrieval system