KEGG   Rhodobacter capsulatus: RCAP_rcc00633Help
Entry
RCAP_rcc00633     CDS       T01213                                 

Definition
(GenBank) ABC transporter, permease protein
  KO
K02004  putative ABC transport system permease protein
Organism
rcp  Rhodobacter capsulatus
Module
rcp_M00258  Putative ABC transport system
Brite
KEGG Orthology (KO) [BR:rcp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rcp02000]
    RCAP_rcc00633
Transporters [BR:rcp02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter [MD:M00258]
    RCAP_rcc00633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsX
Motif
Other DBs
NCBI-ProteinID: ADE84398
UniProt: D5ANP4
Position
complement(686249..687448)
Genome map
AA seq 399 aa AA seqDB search
MLIVSLALRDLFRDRLFLLCNVAVMVGVLVPLLILFGVKNGVYSTLIGRMMADPASLQID
SQGNAELTEARIAPLRAWPEVAFVTPKVRSQFDYVTVHHAGPGVSLREALLIPSGAGDPN
LPPGLVLGPAEVAVSAGLAQQMQIATGDTVDLVTQAETRPKQLRLPMTVRAVLPETVSAG
RSVLAPFATLETVEAFYDAYALPEHGITEGRPLADRVATYAGVRIYARRLEDLGPLQQRV
ETALGLATSARSRDVAMLLGLGRNLDLALGLTTALACCGLAAALLFGFWSDAMRKRGTLA
ALAMLGLPARALALLPLVQALATALIGIAVSFLLYALAARIATRMFGAGLEAEGSIARIS
PAQGGAIILAILGLVLVSATLSAWAAQRVDPARTLREGT
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcgtctctctggcgctgcgcgacctgttccgcgaccggctgtttttgctgtgc
aatgtcgcggtgatggtgggggttctggtgccgctcctgatcctgttcggggtgaagaac
ggtgtctattccacgctgatcggccggatgatggccgatcccgccagcctgcagatcgac
agccagggcaatgccgagctgaccgaggcccggatcgcgccgctgcgcgcctggcccgag
gtcgccttcgtgaccccgaaggtccgcagccagttcgattatgtgaccgtgcatcacgcc
gggcccggggtctcgctgcgcgaggccttgctgatcccctcgggcgcgggggatccgaac
ctgccgccggggctggtgctgggccctgccgaggttgcggtctcggcggggctggcgcag
cagatgcagatcgcgaccggcgacacggtcgatctggtgacccaggccgagacccgcccg
aagcagctgcgcctgccgatgacggtgcgggcggtgctgcccgagacggtgagcgcgggg
cgcagcgtgcttgcgccctttgccacgctggagacggtcgaggccttctatgacgcctat
gccctgcccgagcacggtatcaccgaggggcggccgctggcggaccgggtcgcgacctat
gcgggggtgcggatctatgcgcgccggctggaggatctggggccgctgcagcaacgggtc
gagacggcgctggggctggccacctcggcgcgcagccgtgacgtggcgatgctgctcggg
ctggggcgcaatctggatctggcgctggggctgaccacggcgctggcctgctgcgggctg
gcggcggcgctgctgttcggcttctggtcggatgcgatgcgcaagcggggcacgctggcc
gcgctggcgatgcttggtctgcccgcccgggcgctggcgctgctgccgctggtgcaggcg
ctggcgacggcgctgatcgggatcgcggtgtccttcctgctttatgcgctggccgcccgg
atcgccacgcggatgttcggcgcggggctggaagccgagggcagcatcgcccggatcagc
ccggcgcagggcggggcgatcatcctggcgatcctgggtctggtgctggtgtcggcgacg
ctgtcggcctgggcggcacagcgggtcgatccggcccggaccctgcgggaaggaacctga

DBGET integrated database retrieval system