KEGG   Rhodobacter capsulatus: RCAP_rcc00640Help
Entry
RCAP_rcc00640     CDS       T01213                                 

Definition
(GenBank) peptidase, S1/S6 family
Organism
rcp  Rhodobacter capsulatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trypsin_2 Trypsin
Motif
Other DBs
NCBI-ProteinID: ADE84405
UniProt: D5ANQ1
Position
complement(698315..700087)
Genome map
AA seq 590 aa AA seqDB search
MAEHFLFRSSLQAEDCLSVAGQPVLERHAALHELLTARLGAEAAELFAEPFVSRGAAGAA
LNVAWHSVHAGEARPLADLDPALRRAVEDRLLRLLPKIEALATDPGLTPDLAALVRAALS
LSQAADVRAINGVPVLVNWGVRPRGGAPALAGFMRGDAAAAGPAAAAPGPATVPPPIPDA
AQPGPAMSAGLPPAATRPVLPLAAWLPLPILLVLLCLVLIWLLLPGTRVFPPQSVVRDAD
VSAAQETELGALRDRRDALRQALAGAQCREDGVLVLPGNRTPEGLSLPAPGAAPEQGQVA
PDSPVAPAPERALLPAAPGAPAETDTLLARIEAATVLVIAPGAQGVSTGSGFAVGPGLIV
TNQHVIEDLGPEGAFVVNKLLGQPQPAQVLKTAGPLEAVGADFALLKIGSTALPALPLAD
PAASLKLNHVVAAGFPGDVMETDAAYEALLRGDGAAMPGLVVVDGTVNAEQPLQGATETL
LHSAPLAQGNSGGPLVDFCGRVLGVNTFVRQGPLRTLNFALSAAGLAEFLAGTPAAVTPD
RASCQPTVAPASATPAPTPAPAPAPAAPAPGAPAGAPDGTVPATPGPGGE
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcatttccttttccggtcgtcgctgcaagccgaggactgcctttccgtcgcc
gggcagccggtgctggaacgccatgccgcgctgcacgagctgctcaccgcccggctgggc
gcggaggcggcggagctcttcgccgagcccttcgtcagccgcggcgcggcgggtgcggcg
ctgaacgtcgcctggcattcggtgcatgcgggcgaggcccggccgctggccgatctggac
ccggcgctgcgccgcgcggtcgaggatcggctgctgcggctcttgccgaagatcgaggcg
ctggccaccgatccggggctgacgccggatctggcggcgctggtgcgggcggcgctttcg
ctgtcgcaggcggccgacgtgcgggcgatcaacggcgttccggtgctggtgaactggggc
gtccgcccgcgcggcggggcgcccgcgctggccgggttcatgcgcggcgatgccgcggcg
gccgggcctgccgcggcggcgccggggcccgcgacggtgccgccgccgatccccgatgcc
gcgcagccgggtccggccatgtcggcggggctgccgcccgccgcgacgcgcccggtgctg
ccgctggcggcctggctgccgctgccgatcctgctggttctgctctgcctcgtgctgatc
tggctgttgctgcccggaacccgggtgttcccgccgcaaagcgtggtccgcgatgccgat
gtctcggcggcgcaggaaaccgaactgggcgcgctgcgcgaccgccgcgatgcgctgcgg
caggcgcttgcgggggcgcaatgccgcgaggatggcgttctggtgctgcccgggaaccgc
acgcccgagggcctgtcgcttccggcgcccggcgcggcgcccgaacaggggcaggtggcg
cccgattccccggtcgcccccgcgcccgagcgcgcgctgctgcccgccgcccccggcgcc
cccgcggaaaccgacactctgctggcgcggatcgaggcggccaccgtgctggtgatcgcc
cccggggcgcagggcgtctcgaccgggtcgggctttgccgtcgggccggggctgatcgtc
accaaccagcatgtgatcgaggatctcgggcccgagggcgccttcgtggtgaacaagctg
ctggggcagccgcaaccggcgcaggtgctcaagaccgccggtccgctggaggccgtgggg
gccgatttcgcgctgctgaagatcggttcgaccgcgctgcccgcgctgccgctggccgat
ccggccgcctcgctcaagctcaatcacgtcgtggccgcgggcttcccgggcgatgtgatg
gagaccgacgccgcctatgaggcgctgctgcgcggcgatggcgcggcgatgcccgggctc
gtcgtcgtcgatggcacggtgaatgcggaacagccgctgcagggcgcgaccgagacgctg
ctgcattcggcgccgctggcgcagggcaattccggcgggcccttggtggatttctgcggc
cgggttctcggggtgaacaccttcgtccggcaaggcccgctgcgcacgctgaatttcgcg
ctttcggccgcgggtctggccgagtttctggccggaacccccgccgccgtgacgccggac
cgcgccagctgccaaccgacggtggcgcccgcttcggcgacgcccgccccgacccccgcc
ccggcccccgcccccgccgcgcccgcacccggggcaccggccggagccccggacggcacg
gtcccggcaacgcccggcccgggcggggagtga

DBGET integrated database retrieval system