KEGG   Rhodobacter capsulatus: RCAP_rcc00644Help
Entry
RCAP_rcc00644     CDS       T01213                                 

Gene name
mcpX
Definition
(GenBank) methyl-accepting chemotaxis protein McpX
  KO
K03406  methyl-accepting chemotaxis protein
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp02020  Two-component system
rcp02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rcp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RCAP_rcc00644 (mcpX)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    RCAP_rcc00644 (mcpX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:rcp02035]
    RCAP_rcc00644 (mcpX)
Bacterial motility proteins [BR:rcp02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    RCAP_rcc00644 (mcpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NIT MCPsignal HAMP
Motif
Other DBs
NCBI-ProteinID: ADE84409
UniProt: D5ANQ5
Position
705570..707906
Genome map
AA seq 778 aa AA seqDB search
MVMTLGMPAFLALLFGVFLIVERWTALGDARQVQRLMALAEAAAAVAHDQQLERGMTSLF
LNGKDAAAPDKLTAQWAQTDAARAALITRAETIGLDGLPPQVAALVAELQGDFDKSADLR
SAVDARAIPAPEAIDYYTEMNDDVLQLVEVVASASADAEVNARITSYAAFMTAKERAGLE
RALGAGAFRKGTFDTAVLLKMRAMVAQQDQALQFFAAFATEEDRATVTRLQDLPAAAELA
RMREIAFRFPETQDLGGVTGEAFFATTTARIEAMKQLETEIGAHIAAAAAERARMALIGF
LGYGAIIAGALLVSMLTGTWSVLRTESDVGALVRAADAMAGGQLDVVLPEPRLRETARMG
SALDSFRVSILDGQEIARRAEEEREAHRQSEAQREAAARAGKEARLAREAEAARLEAERD
RQIAAEISAVVTACAEGDFSRRIPLDDKEGILAQICAGLNRIGEITDAGIAEVNTALRHL
AEGDLTYRIRDGFVGVFAEMARSVRAANDSIARTVLTIEAASVTIDGSSSEISTAANDLA
RRSEQNAAMLEQTASALEEMSGSIGSMAGIANDAKDRMREISRRAETGNGIATQAMEAMD
SIRQSSERIAGVLQVIDDIAFQTNLLALNAGVEAARAGESGRGFAVVASEVRALAQRSSD
ASREIAQIIGTATQDVGRGVEMVDQTAGALGQIVGTIREALDRIEHIAGAVGETEVGIAE
ISKATTELDRVTQQNAAMFEQTNAALGALRIEADALVANVAQFRTDKDELSAPRGRAA
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgacgctgggcatgccggcatttctggcgctgctgttcggggtgttcctgatc
gtcgagcgctggaccgcgcttggcgatgcccggcaggtgcagcggttgatggccctggcc
gaggcggccgcggcggtggcgcatgaccagcagctcgaacgcggcatgaccagcctgttc
ctgaacggcaaggatgcggcggcgcccgacaagctgaccgcgcaatgggcgcagaccgat
gctgcgcgggcggcgctgatcacccgggcagagacgatcggactggacgggctgccgccg
caggtggcggcgctggtcgcggagttgcagggcgatttcgacaagagcgccgatctgcgc
agcgcggtcgatgcccgcgccatccccgcgcccgaggcgatcgactattacaccgaaatg
aatgacgacgtgctgcagctggtcgaggtggtggccagcgccagcgccgatgccgaggtc
aatgcccggatcacttcctatgccgccttcatgacggcgaaggaacgcgccgggctggaa
cgcgcgctgggggcgggggcgttccgcaaggggaccttcgacacggcggtgctgctgaag
atgcgcgcgatggtggcgcagcaggaccaggctttgcagttcttcgccgctttcgccacc
gaggaagaccgggcgacggtgacgcggctgcaggatctgcccgccgcggccgagctggcg
cggatgcgcgagatcgcatttcgcttccccgaaacgcaggatcttggcggggtgaccgga
gaggcgtttttcgccacgacgacggcgcggatcgaggcgatgaaacagcttgaaaccgag
atcggcgcccatatcgcggcggcggcggcggaacgggcccggatggcgctgatcggcttt
ctcgggtatggcgcgatcatcgccggggcgctgctggtgtcgatgctgaccgggacgtgg
tcggtgctgcgcaccgaatccgacgtcggcgcgctggtgcgggccgccgatgcgatggcg
ggggggcagctggacgtggtcctgccggaaccgcgcctgcgcgagacggcgcggatgggc
agcgcgcttgacagtttccgggtcagcatccttgacggtcaggagatcgcccgcagggcc
gaggaagagcgcgaggcgcatcgtcagtccgaggcgcagcgcgaggcggcggcgcgggcg
ggcaaggaggcgcggctggcgcgcgaggccgaggcggcgcggcttgaagccgagcgcgac
cgtcagatcgccgccgagatctcggcggtggtgaccgcctgtgccgagggcgatttctcg
cgccggatcccgctggacgacaaggaggggatccttgcccagatctgcgccgggctgaac
cggatcggcgagatcaccgatgccgggatcgccgaggtcaacaccgcgctgcgtcatctg
gccgagggcgatctgacctatcggatccgcgacggcttcgtcggcgtctttgccgagatg
gcgcgttcggtgcgggcggcgaatgacagcatcgcccggaccgtgctgacgatcgaggcg
gcctcggtgacgatcgacggatcgagcagcgagatcagcaccgcggccaatgatctggcg
cggcgcagcgagcagaatgcggcgatgctggagcagaccgcctcggcgctggaggaaatg
tcggggtcgatcggctcgatggcggggatcgccaatgacgccaaggaccgcatgcgcgag
atttcgcgccgggccgagaccggcaatggcatcgccacccaggcgatggaggcgatggac
agcatccgccagtcttccgaacgcatcgcgggggtgttgcaggtgatcgacgacatcgcc
tttcagaccaatcttctggcgctgaatgccggggtcgaggcggcacgggcgggcgaaagc
ggacgcggtttcgccgtcgtcgcctccgaggtgcgggcgttggcgcagcggtcctccgat
gcctcgcgcgagatcgcgcagatcatcggcacggcgacgcaggatgtcggccgcggcgtc
gagatggtcgatcagaccgcgggggcgctggggcagatcgtcggcacgatccgcgaggcg
ctggaccggatcgagcacatcgccggcgccgtgggcgagaccgaggtcggcatcgccgag
atttccaaggcgacgacggaactggaccgggtgacgcagcagaatgccgcgatgttcgag
caaaccaatgccgcgctgggcgccttgcggatcgaggccgatgcgctggtggccaatgtg
gcgcagttccgcaccgacaaggacgagctttcggcgccgcgcggccgcgccgcctga

DBGET integrated database retrieval system