KEGG   Rhodobacter capsulatus: RCAP_rcc00650Help
Entry
RCAP_rcc00650     CDS       T01213                                 

Definition
(GenBank) sulfatase family protein
  KO
K03760  lipid A ethanolaminephosphotransferase [EC:2.7.8.43]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    RCAP_rcc00650
Enzymes [BR:rcp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.43  lipid A phosphoethanolamine transferase
     RCAP_rcc00650
Lipopolysaccharide biosynthesis proteins [BR:rcp01005]
 Lipid A
  RCAP_rcc00650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sulfatase DUF1705
Motif
Other DBs
NCBI-ProteinID: ADE84415
UniProt: D5ANR1
Position
complement(715841..717508)
Genome map
AA seq 555 aa AA seqDB search
MSSTPLPFSPPGPGRAPAPSRVQLSPWGLNLLVAAYLLLALNGGLWSAIFRVFAKDPVAL
VAFGASVSVLLLLLMAFVTLPRLQRPALALMILTAAVAEHFRAAYGVLIDRDMIQNAMLT
TTTESKHLFTLQFFRDIGLWGVLPAALIFVLPLKPVRLRSLIWRWPLGIALTTALLLGLL
VSNYRSFAPAVRNHREMLAAFQPGAPLRAMARYGVLRFATADITAAPYGRDARPGPLLQA
AQKPVLFVLFVGETARAQNFGLNGYGRDTTPELAKLDVVNFTDTSSCGTSTAVSVPCMFS
DLGTEGYAQKRFLGRENLVDILAHAGLKVEWIDNNTGDQQVAKRLGPVTRVDATLDPAAC
AGGECTDAAFLPIIKARMETITENTVLVLHMIGSHGPAYYLRYPADQAVFKPDCRSSAFA
DCKAEEIVNAYDNSIRMTDHVLAETVRMMAAQDRVIPAMYFVSDHGESLGEKGLYLHAAP
MFMAPDEQRKVPFVIWLSQAFQDAMQVPQACLAAQSGAAVSHDNLFHSVLGLLDIRTSVR
KDALDLSHDCRKGGA
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcaccccccttcccttttcgccgcccggacccggcagggcccccgccccgtcg
cgggtgcagctgagcccctgggggctcaatctgctggtcgcggcctatctgcttttggcg
ctgaacggcggcctgtggtcggcgatcttccgggtcttcgccaaggatccggtggcgctg
gtggcctttggcgcctcggtcagcgtgcttttgctgctgctgatggcctttgtcaccctg
ccccggctgcagcgtccagcgctggcgctgatgatcctgaccgccgccgtggccgagcat
ttccgcgccgcctatggcgtgctgatcgaccgcgacatgatccagaacgccatgctgacc
acgacgacggaaagcaagcatctgttcacgctgcagtttttccgcgatatcgggctgtgg
ggcgtgctgcccgcggcgctgatcttcgtcctgccgctgaagccggtgcggctgcgcagc
ctgatctggcgctggccgctggggattgccctgacgacggcgctgctgttggggcttctg
gtcagcaattaccgcagcttcgcccccgccgtgcgcaaccaccgcgagatgctggccgcc
ttccagcccggggcgccgctgcgggcgatggcgcgctatggcgtgctgcgctttgctacc
gccgacatcaccgccgcgccctatggccgcgatgcccgcccggggcccttgctgcaggcg
gcgcaaaagccggtgctcttcgtgcttttcgtcggcgagaccgcgcgggcgcagaatttc
gggctgaacggctatgggcgcgacaccaccccggaactggcgaaacttgacgtggtgaat
ttcaccgacacctcttcttgcggcacctcgaccgcggtgtcggtgccctgcatgttttcc
gatctgggcaccgagggctatgcgcaaaagcgcttccttggccgcgaaaatctggtcgac
atcctggcccatgccgggctgaaggtggaatggatcgacaacaacaccggcgatcagcag
gtggcgaaacggctgggcccggtgacgcgggtcgatgcgacgctggatccggccgcctgt
gcggggggcgaatgcaccgatgccgccttcctgccgatcatcaaggcgcggatggagacg
atcaccgaaaacaccgtgctcgtcctgcacatgatcggcagccacgggccggcctattac
ctgcgctacccggccgatcaggcggtgttcaaacccgattgccggtcttcggcctttgcc
gattgcaaggccgaggaaatcgtcaacgcctatgacaattcgatccgcatgaccgatcat
gtgctggccgagacggtgcggatgatggcggcgcaagaccgcgtgatcccggcgatgtat
ttcgtctcggatcatggcgaaagccttggcgagaaagggctttatctgcatgccgcgccg
atgttcatggcgcctgacgaacagcgcaaggtgcccttcgtgatctggctgtcgcaggcc
ttccaggacgcgatgcaggtgccgcaagcctgtctggcggcgcaatccggggcggcggtg
tcgcatgacaacctcttccattcggtgctgggcctgctcgacatccggacctcggtgcgc
aaggatgcgctggatctgagccacgactgccgcaaggggggggcgtga

DBGET integrated database retrieval system