KEGG   Rhodobacter capsulatus: RCAP_rcc00661Help
Entry
RCAP_rcc00661     CDS       T01213                                 

Gene name
bchM
Definition
(GenBank) magnesium-protoporphyrin O-methyltransferase
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00860  Porphyrin and chlorophyll metabolism
rcp01100  Metabolic pathways
rcp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rcp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RCAP_rcc00661 (bchM)
Enzymes [BR:rcp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     RCAP_rcc00661 (bchM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 Methyltransf_12 MTS PCMT Methyltransf_2 TehB TPMT Ubie_methyltran PrmA CheR Methyltransf_9 NodS CMAS RrnaAD Cons_hypoth95 Methyltransf_32 Methyltransf_16 UPF0146 Methyltransf_15 MethyltransfD12
Motif
Other DBs
NCBI-ProteinID: ADE84426
UniProt: D5ANS2
Position
complement(726541..727215)
Genome map
AA seq 224 aa AA seqDB search
MPSDYAEIRNRVEHYFDRTATRAWARLTTADEKVSKVRQTVREGRDTMRAVMLSRLPDDL
TGCRVMDAGCGTGLTTVELARRGADVVAVDISPQLIDIAKDRLPPELRGKVSFHVGDMAD
PALGQFDYVVAMDSLIYYRAPDIGRVLTELGKRTHSAIVFTVAPKTAFLMAFWWLGKLFP
RSNRSPVMIPHALDKLQRHAGDSLIKIDRVARGFYISECLEYRP
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgccctccgattacgcagagatccgcaaccgcgtcgaacactatttcgaccgcaccgcg
acccgtgcctgggcgcggctgaccaccgcggatgaaaaggtgagcaaggtccgccagacc
gtccgcgaaggccgcgacacgatgcgcgccgtcatgctctcgcgcctgcccgacgatctg
accggctgccgcgtcatggatgcgggttgcggcaccgggctgacgacggtggaactggcc
cggcgcggcgccgatgtggtggcggtggatatctcgccgcagctgatcgacatcgccaag
gaccgcctgccgcccgagctgcgcggcaaggtcagcttccatgtcggcgacatggcggac
ccggcccttggccagttcgattatgtcgtcgcgatggacagcctgatctattaccgcgcg
ccggatatcggccgggtgctgacggaactgggcaagcgcacgcacagcgccatcgtcttc
accgtcgcgccgaaaacggccttcctgatggcgttctggtggctgggcaagcttttcccg
cgctcgaaccgctcgccggtgatgatcccgcatgcgctggacaagctgcagcgccatgcg
ggcgacagcctgatcaagatcgaccgcgtcgcgcgcggtttctacatctcggaatgcctg
gagtatcggccatga

DBGET integrated database retrieval system