KEGG   Rhodobacter capsulatus: RCAP_rcc00667Help
Entry
RCAP_rcc00667     CDS       T01213                                 

Gene name
ppaA
Definition
(GenBank) regulatory protein PpaA
Organism
rcp  Rhodobacter capsulatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: B12-binding
Motif
Other DBs
NCBI-ProteinID: ADE84432
UniProt: D5ANS8
Position
735579..736235
Genome map
AA seq 218 aa AA seqDB search
MNGVAELQTVLVNRMVELATGPELGAMDLLFDEFRAAHVPVEEMATHYIPEAARQIGAAW
DSDRIGFAQVTIAISRLQELLHALQTLVTADSVGCANGATVLLIVPPGEQHTLGALIVAM
ELRRRGVSVRIVFAPGLSDLSRLMATTRFDAALITVGSMDRVEICAKLVKTLSSLTKGRM
RVAIGGAIVSQRAEALARTGADLVTNDLSLVISEFSLV
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaacggagtggcggaactgcagaccgtgcttgtgaacaggatggtcgaactggcaacg
ggaccggagcttggcgcgatggacctgctgttcgacgaattccgtgccgcgcatgtcccg
gtcgaggagatggccacccattacatccccgaggcggcccgccagatcggcgccgcctgg
gacagcgaccggatcggcttcgcgcaggtgacgatcgcgatttcgcgcctgcaggaattg
ctgcatgcgctgcagaccttggtcacggccgactcggttggttgcgctaacggcgccacc
gtccttctgattgtgccgcccggagagcagcacacgctgggcgcgttgatcgtggcgatg
gaactccgccgccggggggtctcggtacggatcgttttcgcgccggggttgagcgatctg
tcacgtttgatggcgacaacccgattcgatgccgctttgatcactgtcggcagcatggac
agggttgaaatctgcgccaaacttgtcaaaaccctgtccagcctgacgaaggggcggatg
cgggttgcgatcggtggggccatcgtgtcgcaacgcgccgaagcactcgcaagaaccgga
gcagatctggtgacgaacgatctttcgctcgtcatttccgaattttctctggtatga

DBGET integrated database retrieval system