KEGG   Rhodobacter capsulatus: RCAP_rcc00669Help
Entry
RCAP_rcc00669     CDS       T01213                                 

Gene name
bchE
Definition
(GenBank) magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase
  KO
K04034  anaerobic magnesium-protoporphyrin IX monomethyl ester cyclase [EC:1.21.98.3]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00860  Porphyrin and chlorophyll metabolism
rcp01100  Metabolic pathways
rcp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rcp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RCAP_rcc00669 (bchE)
Enzymes [BR:rcp01000]
 1. Oxidoreductases
  1.21  Catalysing the reaction X-H + Y-H = X-Y
   1.21.98  With other, known, physiological acceptors
    1.21.98.3  anaerobic magnesium-protoporphyrin IX monomethyl ester cyclase
     RCAP_rcc00669 (bchE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: B12-binding Radical_SAM Fer4_12 Fer4_14 FYDLN_acid
Motif
Other DBs
NCBI-ProteinID: ADE84434
UniProt: P26168
Position
738278..740005
Genome map
AA seq 575 aa AA seqDB search
MRILFVHPNYHSGGAEIAGNWPPSWVPYLAGHLKKAGFDDIHFIDAMTLNVSHDELRKKF
AELQPDLIGVTSITPSIYEAEETLKIAKEVVPNAVRVLGGVHATFMFRQVLSEAPWVDAI
VRGEGEEIMVELAKCVSEGRWPEDRASIKGLAFHDGTEIVATQAAPTVKDIDSLKPDWSL
IDWKHYIYIPLGVRVAIPNMARGCPFTCSFCSQWKFWRDYRVRSPKAVVDEIEDLVNNYD
VGFFILADEEPTINKKKFVEFCQEMIDRGLNHKVKWGINTRVTDIYRDRDLLKFYREAGL
VHISLGTEAAAQLKLDLFNKETTVAENKEAIRLLREADIFTEAQFIVGLDNETKETLEET
FQMAWDWQPDLANWSMYTPWPFTPLFQELRDQVEVFDFSKYNFVTPIMKPKALTRGELLD
GVMKNYRRFYMRKALFHYPWRGTGFRRRYLLGCLKAFLKAGVGRTFYDLGKAGYWGPQTK
DTVDFHFDETRKIAEAQVADWEAAADRSRKHKERQEALRAQMKDRAADRNTANFVMPADA
EDEFDLSAETHEARSAEHAAMACGGGKDQMVDAAE
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatccttttcgtccaccccaattaccactccggcggggccgagatcgcggggaac
tggcccccgtcgtgggtcccctatcttgcgggtcacctgaaaaaagcgggtttcgacgac
atccatttcatcgatgcgatgacgctgaacgtgtcgcatgacgagctgcgcaagaaattt
gccgaactccagcccgacctgatcggcgtgacctcgatcacgccgtcgatctacgaggcg
gaagagacgctgaagatcgccaaggaagtcgtgccgaatgcggtgcgcgttctgggcggc
gtgcatgcgaccttcatgttccgtcaggtgctgtcggaagcgccctgggtcgatgcgatc
gtccgcggcgagggcgaagaaatcatggtcgagctggccaaatgcgtctccgagggccgc
tggccggaagaccgcgcctcgatcaagggtctggccttccatgacggcaccgagatcgtg
gcgacgcaagccgcgccgacggtcaaggacatcgacagcctgaaacccgactggtcgctg
atcgactggaaacactacatctacatcccgctgggcgtgcgcgtggcgatcccgaacatg
gcgcggggctgccccttcacctgctcgttctgctcgcagtggaaattctggcgcgattac
cgcgtccgttcgccgaaggccgtggtcgacgagatcgaagatctggtgaacaactacgac
gtcggcttcttcatcctcgccgacgaggaaccgacgatcaacaagaagaaattcgtcgaa
ttctgtcaggagatgatcgaccgcggtctgaaccacaaggtcaaatggggcatcaacacc
cgcgtgaccgacatctaccgcgaccgcgacctgctgaaattctaccgtgaggcgggcctt
gtccacatctcgctcggcaccgaagccgcggcgcagctgaagctcgacctgttcaacaag
gaaaccaccgtcgccgagaacaaggaggcgatccgccttctgcgcgaggccgacatcttc
accgaagcgcagttcatcgtcggcctcgacaacgagaccaaggaaaccctggaagaaacc
ttccagatggcctgggactggcagccggacctggcgaactggtcgatgtacacgccctgg
cccttcacgccgctcttccaggagctgcgcgatcaggtcgaggtcttcgacttctcgaaa
tacaacttcgtgaccccgatcatgaagcccaaggcgctgacccgcggcgagcttctggac
ggcgtgatgaagaactaccgccgcttctacatgcgcaaggcgctgttccactatccgtgg
cgcggcaccggcttccgccgccgctatctgctcggctgcctcaaggccttcctcaaggcc
ggggtggggcgcaccttctatgacctcggcaaggccggctattggggcccgcagaccaag
gatacggtcgatttccacttcgacgagacccgcaagatcgccgaggcgcaggtcgccgac
tgggaagccgccgccgaccggtcgcgcaagcacaaggaacggcaggaagcgctgcgcgcc
cagatgaaggaccgcgccgccgaccgcaacaccgcgaacttcgtgatgcccgcggatgcg
gaagacgagttcgacctctcggccgaaacgcacgaggcgcgcagcgccgaacatgcggcg
atggcctgcgggggcggcaaggaccagatggtcgacgccgcggaataa

DBGET integrated database retrieval system