KEGG   Rhodobacter capsulatus: RCAP_rcc00674Help
Entry
RCAP_rcc00674     CDS       T01213                                 

Gene name
idi2
Definition
(GenBank) isopentenyl-diphosphate delta-isomerase-2
  KO
K01823  isopentenyl-diphosphate Delta-isomerase [EC:5.3.3.2]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00900  Terpenoid backbone biosynthesis
rcp01100  Metabolic pathways
rcp01110  Biosynthesis of secondary metabolites
rcp01130  Biosynthesis of antibiotics
Module
rcp_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
rcp_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RCAP_rcc00674 (idi2)
Enzymes [BR:rcp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.2  isopentenyl-diphosphate Delta-isomerase
     RCAP_rcc00674 (idi2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX PRY
Motif
Other DBs
NCBI-ProteinID: ADE84439
UniProt: P26173
Position
744073..744615
Genome map
AA seq 180 aa AA seqDB search
MDLTMAEEMIPAWVEGVLQPVEKLEAHRKGLRHLAISVFVTRGNKVLLQQRALSKYHTPG
LWANTCCTHPYWGEDAPTCAARRLGQELGIVGLKLRHMGQLEYRADVNNGMIEHEVVEVF
TAEAPEGIEPQPDPEEVADTEWVRIDALRSEIHANPERFTPWLKIYIEQHRDMIFPPVTA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggacctgaccatggccgaggagatgatccccgcctgggtcgagggcgtgctgcaaccc
gtcgagaagctggaggcccaccgcaagggcctgcggcatctggcgatttcggtcttcgtg
acgcgcggcaacaaggtgcttttgcagcaacgcgcgctgtcgaaatatcacacgccgggg
ctttgggcgaatacctgctgcacccatccctattggggcgaggatgcgccgacctgcgcc
gcccgccgtctggggcaggagctgggcatcgtcgggctgaagctgcgccacatggggcag
ctggaataccgcgccgatgtgaacaacggcatgatcgagcatgaggtggtggaggtcttc
accgccgaagcgcccgaggggatcgagccgcaacccgaccccgaggaagtggccgatacc
gaatgggtgcgcatcgacgcgctgcgctcggagatccacgccaatccggaacgcttcacg
ccctggctcaagatctatatcgagcagcaccgcgacatgatctttccgccggtgacggcc
tga

DBGET integrated database retrieval system