KEGG   Rhodobacter capsulatus: RCAP_rcc01629Help
Entry
RCAP_rcc01629     CDS       T01213                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose-5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00900  Terpenoid backbone biosynthesis
rcp01100  Metabolic pathways
rcp01110  Biosynthesis of secondary metabolites
rcp01130  Biosynthesis of antibiotics
Module
rcp_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:rcp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RCAP_rcc01629 (dxr)
Enzymes [BR:rcp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     RCAP_rcc01629 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C
Motif
Other DBs
NCBI-ProteinID: ADE85374
UniProt: D5ATT5
Position
1761570..1762742
Genome map
AA seq 390 aa AA seqDB search
MRRITVFGSTGSIGVNTLDLIARRPGAFQVVALSGGRNIKLLAEQARAFRAEVAVTAHED
CLPALRDALAGTGIEATAGKAALIEAALRPADWIMSAIVGAAGLAPGFAALSQGTTLALA
NKESLVTAGPLLLAEAAKHNARLLPVDSEHSAVFQALVGEEMAAVERIIITASGGAFRDW
PIEKLAHATVSQASTHPNWAMGQRITIDSASFFNKALELIETKEYFGVRPEQIEVLVHPE
SLVHALVGFKDGALMAHLGAPDMRHAIGYALNWPERAELPVTRLDLAKIGALTFRAPDED
RFPALRLAREVMAMGGTAGAAFNAAKEAALDAFIGEEIGFLAMSRLVEAVLTEMTARHGL
GKPLDSLDMVMDTDATARALARSLVPTVRT
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgcattacggttttcgggtccaccggctcgatcggggtcaatacgcttgacctg
atcgcccgtcgtccgggggcctttcaggtggtggccctgtccggggggcgcaacatcaag
cttctggccgaacaggcgcgggctttccgggccgaggtcgcggtgaccgcgcatgaagat
tgcctgcctgcgctgcgcgacgcgctggccggaaccgggatcgaggcgacggccgggaaa
gccgcgctgatcgaggcggcgctgcgtccggccgactggatcatgtcggccatcgtcggc
gccgcgggtctggcgccgggctttgccgcgctgagccagggcacgacgctcgcgctcgcg
aacaaggaatcgctggtcaccgccgggccgctgcttctggcggaagccgcgaaacacaac
gcccgccttttgcccgtcgacagcgaacattccgcggtctttcaggcgctggtcggcgaa
gagatggcagcggtcgaacgcatcatcatcaccgcctcgggcggggccttccgcgattgg
ccgatcgagaaactggcccatgcgacggtgtcgcaggcctccacccatccgaactgggcg
atggggcaaaggatcaccatcgattccgcgtccttcttcaacaaggccttggaactgatt
gaaaccaaggaatatttcggcgtgcggccagagcagatcgaggttctggtgcaccctgaa
tcgctggtgcatgcgctggtcggcttcaaggacggtgcgctgatggcgcatctgggcgcg
cccgacatgcgccatgccatcggctatgcgctcaattggccggagcgggcggagctgccg
gtgacccgtctggatctggcaaagatcggcgcgctgaccttccgcgcgcccgacgaggac
cgcttcccggcgctgcgtctggcgcgcgaggtgatggcgatgggcggcacggcgggggcg
gccttcaacgccgccaaggaagccgcgctggatgccttcatcggcgaggagatcggtttt
ctggcgatgagccgtctggtcgaagccgtgctgaccgagatgaccgcgcgtcacgggctt
ggaaaaccgctcgacagtctcgatatggtgatggacaccgatgccaccgcgcgggcgctt
gcgcgcagccttgtgccgacagtaaggacctga

DBGET integrated database retrieval system