KEGG   Rhodobacter capsulatus: RCAP_rcc01783
Entry
RCAP_rcc01783     CDS       T01213                                 

Gene name
secF
Definition
(GenBank) protein-export membrane protein SecF
  KO
K03074  preprotein translocase subunit SecF
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp03060  Protein export
rcp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rcp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    RCAP_rcc01783 (secF)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    RCAP_rcc01783 (secF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rcp02044]
    RCAP_rcc01783 (secF)
Secretion system [BR:rcp02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   RCAP_rcc01783 (secF)
SSDB
Motif
Pfam: SecD_SecF Sec_GG
Other DBs
NCBI-ProteinID: ADE85528
UniProt: O33518
Position
1929369..1930370
AA seq 333 aa
MAFRLKLVPEKTNFDFFRWQWATFGAAIVMMIASVILPLVIGLNFGIDFKGGTTIRTEST
TAIDVGVYRAALEPLELGDVIISEVRDPSFREDQHVAMIRIQMQEDGQGAEGQGAQGQEL
VNKVETALTAVDPALKITSFESVGPKVSGELVWTAVWSLLAATVVIMFYIWVRFEWQFAL
GAVVALVHDVLLTVGLFAVLQLKFDLTTVAALLTITGYSINDTVVVFDRLRENLIKYKTM
PLRDVMNLSVNETLSRTVMTGMTTLLALVPMLIWGGDVIRGFVFAMVWGVFTGTYSSVYV
AKNIVLFIGLDRNKEKKDPSDKFFSNGAQDGAP
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggctttccgtctgaaactggttcccgaaaagaccaacttcgactttttccgctggcaa
tgggcgaccttcggggcggccatcgtgatgatgatcgcctcggtgatcctgccgctggtg
atcgggctgaacttcggcatcgacttcaagggcggcacgacgatccgcaccgaatccacg
acggcgatcgatgtcggcgtctatcgggccgcgctggagccgctcgagcttggcgatgtg
atcatctccgaggtccgcgaccccagcttccgcgaagatcagcatgtggcgatgatccgc
atccagatgcaggaggacgggcagggcgccgaggggcagggcgcgcagggccaggagctg
gtgaacaaggtcgagaccgcgctgaccgcggtcgatccggcgctgaagatcacctcgttt
gaatccgtcggccccaaggtctcgggcgagctggtctggaccgcggtctggtcgcttctg
gcggcgaccgtggtgatcatgttctacatctgggtccggttcgaatggcaattcgcgctt
ggcgccgtggtggcgcttgtccatgacgtgctgctgacggtcgggcttttcgccgtgctg
cagctgaagttcgatctgaccacggtggcggcgctgttgacgatcaccggctattcgatc
aacgacaccgtcgtcgtctttgaccggctgcgcgaaaacctgatcaaatacaagacgatg
ccgctgcgcgacgtgatgaacctgtcggtcaacgaaacgctttcgcgcacggtgatgacc
ggcatgacgacgcttctggcgctggtgccgatgctgatctggggcggcgacgtgatccgc
ggcttcgtcttcgccatggtctggggggtgttcaccggcacctattcctcggtctatgtg
gcgaagaacatcgtgctgttcatcggtcttgaccgcaacaaggagaagaaggacccctcg
gacaagttcttctcgaacggggcgcaagatggcgccccgtga

DBGET integrated database retrieval system