KEGG   Rhodobacter capsulatus: RCAP_rcc02408Help
Entry
RCAP_rcc02408     CDS       T01213                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp00030  Pentose phosphate pathway
rcp00480  Glutathione metabolism
rcp01100  Metabolic pathways
rcp01110  Biosynthesis of secondary metabolites
rcp01120  Microbial metabolism in diverse environments
rcp01130  Biosynthesis of antibiotics
rcp01200  Carbon metabolism
Module
rcp_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:rcp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RCAP_rcc02408 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RCAP_rcc02408 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rcp04147]
    RCAP_rcc02408 (zwf)
Enzymes [BR:rcp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     RCAP_rcc02408 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     RCAP_rcc02408 (zwf)
Exosome [BR:rcp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   RCAP_rcc02408 (zwf)
  Exosomal proteins of colorectal cancer cells
   RCAP_rcc02408 (zwf)
  Exosomal proteins of bladder cancer cells
   RCAP_rcc02408 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ADE86138
UniProt: D5ALS7
Position
complement(2580839..2582314)
Genome map
AA seq 491 aa AA seqDB search
MVSRVIPVDLFDLVIFGATGDLAQRKILPGLYRRFHAGQMPEGARIIGAARSDMDAEGFR
AQVTKAIADFVDPAKHDAATIAAFLQSLDYVSVDATGEGGWDSLKAKVDPARINAFYFSV
APMLFGPLADRLKAHGIAGDQSRIVVEKPFGRDLASARALNATLAAHFEESQIYRIDHYL
GKETVQNLMAVRFANILFEPLWNAQYIDHVQITVAETVGVGGRGSYYDKSGAMRDMVQNH
LMQLLCLIAMEPPYHFDPDAVRDEKVKVIRALQPVPAADIVRGQYLGVKATAGRAEQPGY
LADSENPDSRTESYIALKVQVANWRWQGTPFYLRTGKRLRGRASEIAITFKAPPHSIFDQ
EEASWRENVLVIRLQPDEGMNLKVMIKEPGPGGMRLVQVPLDMSFAEALGEDGADIPDAY
ERLIMDVIRGNQTLFMRGDEVEAAWAWTDPIIAGWEARGDRPRPYDAGSSGPEDALMLMH
RDGRRWREIRE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcgcgcgtcattccggtcgatcttttcgatctcgtgatcttcggagccacgggc
gatcttgcgcagcgcaagatcctgcccgggctttaccgccgctttcacgccggtcagatg
cccgaaggcgcgcggatcatcggcgccgcccgctccgacatggatgccgagggctttcgc
gcccaggtgaccaaggcgatcgccgatttcgtcgatccggcgaaacatgacgcggcgacc
atcgccgcctttctgcaaagccttgactatgtctcggtcgatgcgacgggcgagggcggc
tgggacagtctcaaggccaaggtcgatcccgcgcggatcaatgccttctatttctcggtc
gcgccgatgctgttcggccccctggccgaccggctcaaggcgcatgggatcgccggggat
cagtcgcgcatcgtggtggaaaaacccttcggccgcgatctggcctcggcccgggccttg
aacgccaccttggccgcgcatttcgaggaaagccagatctaccggatcgaccattatctg
ggcaaggagacggtgcagaacctgatggcggtgcggttcgccaacatcctgttcgagccg
ctttggaacgcacaatatatcgaccatgtgcagatcaccgtggccgaaaccgtgggtgtc
ggcgggcgcggcagctattacgacaaatcgggcgcgatgcgcgacatggtgcaaaaccac
ctgatgcagctgttgtgcctgatcgcgatggagccgccctatcacttcgaccccgatgcg
gtgcgcgatgaaaaggtcaaggtgatccgggccttgcagcccgttcccgcggccgacatc
gtgcgcgggcaatatctgggcgtgaaggccacggccgggcgggccgagcagccgggctat
ctggccgacagcgaaaaccccgacagccgcaccgaaagctatatcgcgctcaaggtgcag
gtggcgaactggcgctggcagggcacgccgttctatctgcgcaccggcaagcggctgcgg
ggccgggccagtgaaatcgccatcaccttcaaggcgccgccgcattcgatcttcgatcag
gaagaagccagctggcgcgaaaacgtgcttgtcatccggctgcaaccggacgagggcatg
aatctgaaagtgatgatcaaggaaccgggtccgggggggatgcgtctggtgcaggtgccg
cttgacatgtcctttgccgaggctctgggcgaggatggcgccgacattcctgacgcttat
gaacgcctcatcatggatgtgatccgcggcaaccagacccttttcatgcgcggcgacgag
gtcgaggccgcctgggcctggaccgatccgatcatcgcgggctgggaggcccggggcgac
cggccgcggccctatgacgccgggtcttcggggccggaagatgccttgatgctgatgcac
cgcgacggccgtcgctggcgggagatccgcgaatga

DBGET integrated database retrieval system