KEGG   Rhodobacter capsulatus: RCAP_rcc02478Help
Entry
RCAP_rcc02478     CDS       T01213                                 

Gene name
groL
Definition
(GenBank) chaperonin GroL
  KO
K04077  chaperonin GroEL
Organism
rcp  Rhodobacter capsulatus
Pathway
rcp03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:rcp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    RCAP_rcc02478 (groL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rcp03019]
    RCAP_rcc02478 (groL)
   03110 Chaperones and folding catalysts [BR:rcp03110]
    RCAP_rcc02478 (groL)
   03029 Mitochondrial biogenesis [BR:rcp03029]
    RCAP_rcc02478 (groL)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rcp04147]
    RCAP_rcc02478 (groL)
Messenger RNA biogenesis [BR:rcp03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     RCAP_rcc02478 (groL)
Chaperones and folding catalysts [BR:rcp03110]
 Heat shock proteins
  HSP60 / Chaperonin
   RCAP_rcc02478 (groL)
Mitochondrial biogenesis [BR:rcp03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    RCAP_rcc02478 (groL)
Exosome [BR:rcp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RCAP_rcc02478 (groL)
  Exosomal proteins of other body fluids (saliva and urine)
   RCAP_rcc02478 (groL)
  Exosomal proteins of breast cancer cells
   RCAP_rcc02478 (groL)
  Exosomal proteins of colorectal cancer cells
   RCAP_rcc02478 (groL)
  Exosomal proteins of bladder cancer cells
   RCAP_rcc02478 (groL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cpn60_TCP1
Motif
Other DBs
NCBI-ProteinID: ADE86208
UniProt: D5AMD2
Position
2660269..2661906
Genome map
AA seq 545 aa AA seqDB search
MAAKEVKFSTDARDRMLKGVNILADAVKVTLGPKGRNVVIEKSFGAPRITKDGVSVAKEI
ELADKFENMGAQMVKEVASRTNDEAGDGTTTATVLAQAIVREGMKAVAAGMNPMDLKRGI
DLATTTVVEAIKAAARPVKDSDEVAQVGTISANGEAQIGRFIADAMQKVGNEGVITVEEN
KGMDTEVEVVEGMQFDRGYLSPYFVTNPDKMIADLEDAYILLHEKKLSSLQPMVPLLEAV
IQSTRPLIIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGFGDRRKAMLQDIAILTGGQV
ISDDLGMKLENVTLDMLGRAKKVTISKENTTIVDGHGDKAEINARVAQIRTQIEETTSDY
DREKLQERVAKLAGGVAVIRVGGMTEVEVKERKDRVDDALNATRAAVQEGIIVGGGVALV
QAAKKLNDLTGANSDQDAGISIVRRALEAPLRQIAENAGVDGAVVAGKVRESADPAFGFN
AQTEEYGDMFGFGVIDPAKVTRTALEDAASIAGLLITTECMIAEKPEPKAAPAGGMGGMG
GMDMM
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaaagaagtcaaattctcgaccgacgcccgcgaccggatgctgaaaggcgtc
aacatcctcgccgatgcggtcaaggtgacgctcggcccgaaaggccgcaacgtggtcatc
gaaaagtcgttcggtgcgccgcgcatcaccaaggacggtgtctcggtcgccaaggaaatc
gaactggccgacaagttcgagaacatgggcgcgcagatggtgaaggaagtcgcttcccgc
accaatgacgaagccggtgacggcaccaccaccgcgaccgttctggcgcaagccattgtc
cgcgaaggcatgaaagccgtcgccgcgggcatgaacccgatggatctgaaacgcggcatc
gacctggccaccaccacggtcgtcgaagcgatcaaggccgccgcccgcccggtgaaagac
agcgacgaagtcgcgcaagtcggcaccatctcggccaacggcgaagcccagatcggccgc
ttcatcgcggacgcgatgcagaaagtcggcaacgagggtgtgatcaccgtcgaagaaaac
aagggcatggacaccgaagtcgaagtcgtcgaagggatgcaattcgaccgcggctacctg
agcccctatttcgtcaccaaccccgacaagatgatcgcggatctggaagacgcctacatc
ctgctgcacgagaaaaaactgagctcgctgcagccgatggtgccgctgctggaagccgtg
atccagtcgacccgtccgctgatcatcgtcgcggaagatgtcgaaggcgaagcgctggcg
accctcgtcgtcaacaagctgcgtggcggcctgaagatcgccgccgtcaaggcgccgggc
ttcggggatcgtcgcaaggcgatgctgcaggacatcgcgatcctgaccggcggtcaggtg
atctcggacgacctcggcatgaagctggaaaacgtcacgctcgacatgctcggccgtgcg
aagaaggtcacgatctcgaaagagaacaccacgatcgtcgacggtcatggcgacaaggcg
gaaatcaacgcccgcgtggcgcagatccgcacccagatcgaggaaaccacctcggactac
gaccgcgaaaaactgcaagagcgcgtggcgaaactcgccggtggcgttgcggtgatccgc
gtcggcggcatgaccgaagtcgaagtgaaagagcgcaaggaccgcgttgatgacgcgctg
aacgcgacccgtgcggccgtgcaagaaggcatcatcgtcggcggcggcgtggctctggtt
caggccgcgaagaagctgaacgacctgaccggcgcgaattcggatcaggatgcgggcatc
tcgatcgtgcgtcgcgcgctggaagcgccgctgcgtcagatcgccgaaaacgcgggcgtc
gatggcgccgtcgtggcgggcaaggtgcgtgaatcggccgacccggccttcggcttcaac
gcccagaccgaagaatatggcgacatgttcggtttcggcgtcatcgacccggccaaggtc
acccgcaccgcgctggaagatgcggcctcgatcgccggtctcttgatcaccaccgaatgc
atgatcgccgaaaagcccgagccgaaagcggccccggccggcggcatgggcggcatgggc
ggcatggacatgatgtaa

DBGET integrated database retrieval system