KEGG   Ricinus communis (castor bean): 107262367Help
Entry
107262367         CDS       T01087                                 

Definition
(RefSeq) probable glutathione peroxidase 4
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu00480  Glutathione metabolism
rcu00590  Arachidonic acid metabolism
rcu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107262367
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107262367
Enzymes [BR:rcu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     107262367
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin AHJR-like
Motif
Other DBs
NCBI-GeneID: 107262367
NCBI-ProteinID: XP_015583238
Position
Unknown
AA seq 169 aa AA seqDB search
MGASPSVPEKSIHEFTVKDARGQDVDLSIYKGKVLLVVNVASKCGFTDTNYTQLTDLYNK
YKDQGFEVLAFPCNQFLKQEPGSSEEAQEFACTRYKAEYPIFQKVRVNGANTAPVYKFLK
ASKFGFMGSGIKWNFTKFLVSKDGQVINRYGPTTSPLSIEDEIKKALEK
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgggggcttctccatcagttccagaaaaatctatccatgaattcactgtcaaggatgcc
agaggtcaggatgtggacctcagtatctataaaggaaaagttcttcttgtcgttaatgtg
gcctccaaatgtggatttacagatactaattatacccagttaactgatctttataacaag
tataaggaccaaggttttgaagttttggcatttccatgcaatcaattcctgaaacaagag
cctggatcaagcgaagaagcacaagaatttgcctgtacacgatacaaggctgaatatcct
attttccaaaaggttcgagtcaatggggcaaatacagcgcctgtttacaagttcctcaag
gcaagcaaatttggatttatggggtctggcataaaatggaattttacgaagtttctagtc
agtaaggatgggcaagtcatcaaccgatatggaccaaccaccagtcctttgtccattgag
gatgaaatcaagaaagccctggaaaaatag

DBGET integrated database retrieval system