KEGG   Ricinus communis (castor bean): 8259780Help
Entry
8259780           CDS       T01087                                 

Definition
(RefSeq) uncharacterized protein LOC8259780
  KO
K02890  large subunit ribosomal protein L22
Organism
rcu  Ricinus communis (castor bean)
Pathway
rcu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rcu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    8259780
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rcu03011]
    8259780
Ribosome [BR:rcu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    8259780
  Bacteria
    8259780
  Archaea
    8259780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 8259780
NCBI-ProteinID: XP_002524085
UniProt: B9SDL6
Position
Unknown
AA seq 278 aa AA seqDB search
MVGWQRHLQFLLRQVGKRVEHNYSAVSNFSSSSSCVESSLKPGDLPCLHRLWKSPSTNIS
RSFYQYLQQSGISSSRKLLADSSEQTPIRSPLTPALTPLSSGKTEEKKAICKQSKVQAVL
KNIKQSPKKVNLVAELVRGMRVEDALLQLQVTIKRAAKTVYQVIHSARANATHNHGLDPD
RLLVAEAFVGKGNFKKRISYHAKGRAGVKVRAECRLTVVVREITPEEEAKIARLRVHNFR
KRTKQEKRLVPHKLIETTPIWNRKKAKAADYEPDGMAA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggtgggctggcagagacatttgcagtttttacttcgccaggttgggaaaagagtggag
cataattactctgctgtctccaacttttcatcttcttcttcctgtgtggaatcatctcta
aaacctggcgatttaccgtgtttacatagattatggaaatcaccttctaccaacatctcg
aggtctttctatcaatatttgcaacagtcgggtatatcaagttcaaggaagttattagca
gattcttctgagcagacacccatccgatcacctttgactcctgcattaactccactaagc
agtggaaaaactgaagaaaagaaggcaatctgtaaacaatcaaaagttcaagcagtactt
aagaacataaaacagagtcctaagaaggtcaacctggttgctgaactagttcgcggcatg
cgtgttgaagatgcacttttgcagttgcaagtaacaattaagcgagctgcaaaaactgtc
taccaggttattcactcagctagagcaaatgcaactcataatcatgggttggatccagat
cgcctccttgttgctgaggcatttgttggaaagggaaatttcaagaagagaatttcctac
catgcaaagggaagagctggagttaaagtgagagcagaatgtcgactgactgtcgtagtg
agggagataacccctgaagaggaggctaagattgccaggctaagagtgcacaatttccgc
aagcgcactaagcaggagaagaggcttgtgccacacaagcttattgagaccactccaatt
tggaatcgcaaaaaagccaaagctgctgattatgagcctgatggcatggctgcatga

DBGET integrated database retrieval system